Description
Overview
Product name | CFP Rabbit pAb |
---|---|
Catalog No. | A5398 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Background
This gene encodes a plasma glycoprotein that positively regulates the alternative complement pathway of the innate immune system. This protein binds to many microbial surfaces and apoptotic cells and stabilizes the C3- and C5-convertase enzyme complexes in a feedback loop that ultimately leads to formation of the membrane attack complex and lysis of the target cell. Mutations in this gene result in two forms of properdin deficiency, which results in high susceptibility to meningococcal infections. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Immunogen information
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 190-469 of human CFP (NP_001138724.1). |
---|---|
Sequence | CPTHGAWATWGPWTPCSASCHGGPHEPKETRSRKCSAPEPSQKPPGKPCPGLAYEQRRCTGLPPCPVAGGWGPWGPVSPCPVTCGLGQTMEQRTCNHPVPQHGGPFCAGDATRTHICNTAVPCPVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGRKFDGHRCAGQQQDIRHCYSIQHCPLKGSWSEWSTWGLCMPPCGPNPTRARQRLCTPLLPKYPPTVSMVEGQGEKNVTFWGRPLPRCEELQGQKLVVEEKRPCLHVPACKDPEEEEL |
Gene ID | |
Swiss Prot | |
Synonyms | BFD; PFC; PFD; PROPERDIN |
Calculated MW | 51kDa |
Observed MW | 51KDa |
Applications
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.01% thiomersal, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Human plasma |
Cellular location | Secreted |
Research Area
CFP Rabbit pAb images
Western blot analysis of Human plasma, using CFP antibody (A5398) at 1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.
Immunohistochemistry of paraffin-embedded human colon carcinoma using CFP Rabbit pAb (A5398) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of NIH-3T3 cells using CFP Rabbit pAb (A5398) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of U-2 OS cells using CFP Rabbit pAb (A5398) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
* For research use only. Not for therapeutic or diagnostic purposes.