Description
Overview
| Product name | [KO Validated] Caspase-3 Rabbit pAb |
|---|---|
| Catalog No. | A2156 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulatory element binding proteins as well as caspases 6, 7, and 9. This protein itself is processed by caspases 8, 9, and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer’s disease.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 29-175 of human Caspase-3 (NP_004337.2). |
|---|---|
| Sequence | SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD |
| Gene ID | |
| Swiss Prot | |
| Synonyms | CPP32; SCA-1; CPP32B |
| Calculated MW | 32kDa |
| Observed MW | 32KDa/17KDa |
Applications
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.01% thiomersal, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | Jurkat, Mouse lung, Rat liver |
| Cellular location | Cytoplasm |
| Customer validation |
(HeLa, Mouse kidney, Rat brain, Human uterine stromal cells, B6, NMuMG) WB(Homo sapiens, Mus musculus, Panax notoginseng (Burk.) F. H. Chen ex C. Chow, Sus scrofa, Gallus gallus, Bos taurus, Rattus norvegicus, Spodoptera frugiperda, Ctenopharyngodon, Ctenopharyngodon idellus, lamprey, quails, S. aureus, H. cordata, Piglet, gga, Sus domesticus, Capra hircus) IHC(Mus musculus, Actinopterygii, Danio rerio, Rattus norvegicus, Homo sapiens) IHC(Mus musculus) Co-IP(Mus musculus) FC(Mus musculus) ICC(Homo sapiens) IP(Homo sapiens) IF(Mus musculus, Homo sapiens, Rattus norvegicus) IF(Mus musculus) IHC(Mus musculus) PCR(Mus musculus) WB(Rattus norvegicus) |
Research Area
- Research Area & PathwaysSignal TransductionErbB-HER Signaling Pathway
- Research Area & PathwaysCell Biology & Developmental BiologyApoptosisCaspases
- Research Area & PathwaysCell Biology & Developmental BiologyApoptosisMitochondrial Control of Apoptosis
- Research Area & PathwaysCell Biology & Developmental BiologyApoptosisInhibition of Apoptosis
- Research Area & PathwaysCell Biology & Developmental BiologyDeath Receptor Signaling Pathway
- Research Area & PathwaysCell Biology & Developmental BiologyHippo Signaling Pathway
- Research Area & PathwaysNeuroscienceNeurodegenerative DiseasesAmyloid Plaque and Neurofibrillary Tangle Formation in Alzheimer’s Disease
[KO Validated] Caspase-3 Rabbit pAb images
![ABclonal:Western blot - [KO Validated] Caspase-3 Rabbit pAb (A2156)}](https://abclonal.com/Uploads/Catalog/A2156/A2156_1.jpg?t=1681788931 "ABclonal:Western blot - [KO Validated] Caspase-3 Rabbit pAb (A2156)")
Western blot analysis of extracts of Jurkat, using Caspase-3 antibody (A2156) at 1:1000 dilution.Jurkat cells were treated by Etoposide (25 uM) at 37℃ for 5 hours.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.
![ABclonal:Western blot - [KO Validated] Caspase-3 Rabbit pAb (A2156)}](https://abclonal.com/Uploads/Catalog/A2156/A2156_2.jpg?t=1681788936 "ABclonal:Western blot - [KO Validated] Caspase-3 Rabbit pAb (A2156)")
Western blot analysis of extracts from normal (control) and Caspase-3 knockout (KO) 293T cells, using Caspase-3 antibody (A2156) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.
![ABclonal:Immunohistochemistry - [KO Validated] Caspase-3 Rabbit pAb (A2156)}](https://abclonal.com/Uploads/Catalog/A2156/A2156_3.jpg?t=1681788967 "ABclonal:Immunohistochemistry - [KO Validated] Caspase-3 Rabbit pAb (A2156)")
Immunohistochemistry of paraffin-embedded rat spleen using [KO Validated] Caspase-3 Rabbit pAb (A2156) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
![ABclonal:Immunofluorescence - [KO Validated] Caspase-3 Rabbit pAb (A2156)}](https://abclonal.com/Uploads/Catalog/A2156/A2156_4.jpg?t=1681788978 "ABclonal:Immunofluorescence - [KO Validated] Caspase-3 Rabbit pAb (A2156)")
Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] Caspase-3 Rabbit pAb (A2156) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
![ABclonal:Immunofluorescence - [KO Validated] Caspase-3 Rabbit pAb (A2156)}](https://abclonal.com/Uploads/Catalog/A2156/A2156_5.jpg?t=1681788990 "ABclonal:Immunofluorescence - [KO Validated] Caspase-3 Rabbit pAb (A2156)")
Immunofluorescence analysis of PC-12 cells using [KO Validated] Caspase-3 Rabbit pAb (A2156) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
![ABclonal:Immunofluorescence - [KO Validated] Caspase-3 Rabbit pAb (A2156)}](https://abclonal.com/Uploads/Catalog/A2156/A2156_6.jpg?t=1681789002 "ABclonal:Immunofluorescence - [KO Validated] Caspase-3 Rabbit pAb (A2156)")
Immunofluorescence analysis of PC-12 cells using [KO Validated] Caspase-3 Rabbit pAb (A2156) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
![ABclonal:Immunofluorescence - [KO Validated] Caspase-3 Rabbit pAb (A2156)}](https://abclonal.com/Uploads/Catalog/A2156/A2156_7.jpg?t=1681789015 "ABclonal:Immunofluorescence - [KO Validated] Caspase-3 Rabbit pAb (A2156)")
Immunofluorescence analysis of U2OS cells using [KO Validated] Caspase-3 Rabbit pAb (A2156) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
* For research use only. Not for therapeutic or diagnostic purposes.
