Description
Overview
Product name | [KO Validated] STAT3 Rabbit mAb |
---|---|
Catalog No. | A19566 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2603 |
Background
The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. This gene also plays a role in regulating host response to viral and bacterial infections. Mutations in this gene are associated with infantile-onset multisystem autoimmune disease and hyper-immunoglobulin E syndrome.
Immunogen information
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 600-700 of human STAT3 (P40763). |
---|---|
Sequence | TKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPG |
Gene ID | |
Swiss Prot | |
Synonyms | APRF; HIES; ADMIO; ADMIO1 |
Calculated MW | 88kDa |
Observed MW | 86KDa |
Applications
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunoprecipitation |
Positive samples | HeLa, A-549, NIH/3T3, C6, Mouse liver |
Cellular location | Cytoplasm, Nucleus |
Customer validation |
WB(Homo sapiens, Mus musculus, Rattus norvegicus, Staphylococcus aureus) IF(Homo sapiens) IP(Homo sapiens) |
Research Area
- Research Area & PathwaysEpigenetics & Nuclear SignalingTranscription Factors
- Research Area & PathwaysProtein phosphorylation
- Research Area & PathwaysSignal TransductionErbB-HER Signaling Pathway
- Research Area & PathwaysSignal TransductionMAPK-Erk Signaling Pathway
- Research Area & PathwaysSignal TransductionMAPK-JNK Signaling Pathway
- Research Area & PathwaysCell Biology & Developmental BiologyApoptosisInhibition of Apoptosis
- Research Area & PathwaysCell Biology & Developmental BiologyCytoskeletonMicrotubules
- Research Area & PathwaysImmunology & InflammationJak-Stat-IL-6 Receptor Signaling Pathway
- Research Area & PathwaysStem CellsEmbryonic Stem Cells
- Research Area & PathwaysCardiovascularHeartCardiogenesis
- Research Area & PathwaysCardiovascularHeartHypertrophy
- ProductsRecombinant ProteinsDrug Targets
[KO Validated] STAT3 Rabbit mAb images
Western blot analysis of various lysates, using STAT3 antibody (A19566) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.
Western blot analysis of extracts from normal (control) and STAT3 knockout (KO) HeLa(KO) cells, using STAT3 antibody (A19566) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.
Immunohistochemistry of paraffin-embedded human breast cancer using [KO Validated] STAT3 Rabbit mAb (A19566) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human colon carcinoma using [KO Validated] STAT3 Rabbit mAb (A19566) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
* For research use only. Not for therapeutic or diagnostic purposes.