FREE SHIPPING IN GERMANY ON ORDERS OVER € 500 & € 1000 ACROSS EUROPE!

[KO Validated] STAT3 Rabbit mAb

From: 210.00

SKU: [KO Validated] STAT3 Rabbit mAb - A19566 - ABclonal Category:

Description

Overview

Product name [KO Validated] STAT3 Rabbit mAb
Catalog No. A19566
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC2603

The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein is activated through phosphorylation in response to various cytokines and growth factors including IFNs, EGF, IL5, IL6, HGF, LIF and BMP2. This protein mediates the expression of a variety of genes in response to cell stimuli, and thus plays a key role in many cellular processes such as cell growth and apoptosis. The small GTPase Rac1 has been shown to bind and regulate the activity of this protein. PIAS3 protein is a specific inhibitor of this protein. This gene also plays a role in regulating host response to viral and bacterial infections. Mutations in this gene are associated with infantile-onset multisystem autoimmune disease and hyper-immunoglobulin E syndrome.

Immunogen A synthetic peptide corresponding to a sequence within amino acids 600-700 of human STAT3 (P40763).
Sequence TKPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPG
Gene ID
Swiss Prot
Synonyms APRF; HIES; ADMIO; ADMIO1
Calculated MW 88kDa
Observed MW 86KDa

Reactivity Human, Mouse, Rat
Tested applications WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition
Recommended dilution
  • WB 1:500 – 1:1000
  • IHC-P 1:50 – 1:200
  • IP 1:50 – 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application Western blotting    Immunohistochemistry    Immunoprecipitation    
Positive samples HeLa, A-549, NIH/3T3, C6, Mouse liver
Cellular location Cytoplasm, Nucleus
Customer validation

WB(Homo sapiens, Mus musculus, Rattus norvegicus, Staphylococcus aureus)

IF(Homo sapiens)

IP(Homo sapiens)

ABclonal:Western blot - [KO Validated] STAT3 Rabbit mAb (A19566)}

Western blot – [KO Validated] STAT3 Rabbit mAb (A19566)

Western blot analysis of various lysates, using STAT3 antibody (A19566) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.
ABclonal:Western blot - [KO Validated] STAT3 Rabbit mAb (A19566)}

Western blot – [KO Validated] STAT3 Rabbit mAb (A19566)

Western blot analysis of extracts from normal (control) and STAT3 knockout (KO) HeLa(KO) cells, using STAT3 antibody (A19566) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.
ABclonal:Immunohistochemistry - [KO Validated] STAT3 Rabbit mAb (A19566)}

Immunohistochemistry – [KO Validated] STAT3 Rabbit mAb (A19566)

Immunohistochemistry of paraffin-embedded human breast cancer using [KO Validated] STAT3 Rabbit mAb (A19566) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KO Validated] STAT3 Rabbit mAb (A19566)}

Immunohistochemistry – [KO Validated] STAT3 Rabbit mAb (A19566)

Immunohistochemistry of paraffin-embedded human colon carcinoma using [KO Validated] STAT3 Rabbit mAb (A19566) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

* For research use only. Not for therapeutic or diagnostic purposes.

Datasheet

Additional information

CatalogID

A19566-100, A19566-200, A19566-50