Description
Overview
| Product name | CMIP Rabbit pAb |
|---|---|
| Catalog No. | A20487 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
This gene encodes a c-Maf inducing protein that plays a role in T-cell signaling pathway. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 640-773 of human CMIP (NP_938204.2). |
|---|---|
| Sequence | RLTLPSKSTDADLARLLSSGSFGNLENLSLAFTNVTSACAEHLIKLPSLKQLNLWSTQFGDAGLRLLSEHLTMLQVLNLCETPVTDAGLLALSSMKSLCSLNMNSTKLSADTYEDLKAKLPNLKEVDVRYTEAW |
| Gene ID | |
| Swiss Prot | |
| Synonyms | TCMIP |
| Calculated MW | 86kDa |
| Observed MW | 70KDa |
Applications
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | K-562, Mouse testis, Mouse kidney, Rat kidney |
| Cellular location | cytosol, nucleoplasm |
Research Area
CMIP Rabbit pAb images
Western blot analysis of extracts of various cell lines, using CMIP antibody (A20487) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.
Western blot analysis of extracts of K-562 cells, using CMIP antibody (A20487) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.
Immunohistochemistry of paraffin-embedded mouse fetal liver using CMIP Rabbit pAb (A20487) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
* For research use only. Not for therapeutic or diagnostic purposes.
