FREE SHIPPING IN GERMANY ON ORDERS OVER € 500 & € 1000 ACROSS EUROPE!

[KO Validated] active + pro Caspase-3 Rabbit mAb

From: €210.00

SKU: [KO Validated] active + pro Caspase-3 Rabbit mAb - A19654 - ABclonal Category:

Description

Overview

Product name [KO Validated] active + pro Caspase-3 Rabbit mAb
Catalog No. A19654
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0133

The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulatory element binding proteins as well as caspases 6, 7, and 9. This protein itself is processed by caspases 8, 9, and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer’s disease.

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-175 of human Caspase-3 (P42574).
Sequence SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETD
Gene ID
Swiss Prot
Synonyms CPP32; SCA-1; CPP32B
Calculated MW 32kDa
Observed MW 17KDa/32kDa/35KDa

Reactivity Human, Mouse, Rat
Tested applications WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition
Recommended dilution
  • WB 1:500 – 1:1000
  • IF/ICC 1:50 – 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application Western blotting    Immunofluorescence    
Positive samples Jurkat, Mouse lung, Mouse liver, NIH/3T3, Rat liver, 293T, L929
Cellular location Cytoplasm
Customer validation

WB(Mus musculus, Homo sapiens, Sanghuangporus vaninii, Giardia duodenalis, Rattus norvegicus, Apocynum venetum leaf, Gallus gallus, Bos taurus)

IP(Rattus norvegicus)

ABclonal:Western blot - [KO Validated] active + pro Caspase-3 Rabbit mAb (A19654)}

Western blot – [KO Validated] active + pro Caspase-3 Rabbit mAb (A19654)

Western blot analysis of various lysates, using active + pro Caspase-3 antibody (A19654) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.
ABclonal:Western blot - [KO Validated] active + pro Caspase-3 Rabbit mAb (A19654)}

Western blot – [KO Validated] active + pro Caspase-3 Rabbit mAb (A19654)

Western blot analysis of extracts of Rat liver, using Integrin-β1/CD29 antibody (A19654) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.
ABclonal:Western blot - [KO Validated] active + pro Caspase-3 Rabbit mAb (A19654)}

Western blot – [KO Validated] active + pro Caspase-3 Rabbit mAb (A19654)

Western blot analysis of extracts of Jurkat, using active + pro Caspase-3 antibody (A19654) at 1:1000 dilution.Jurkat cells were treated by Etoposide (25 uM) at 37℃ for 5 hours.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.
ABclonal:Western blot - [KO Validated] active + pro Caspase-3 Rabbit mAb (A19654)}

Western blot – [KO Validated] active + pro Caspase-3 Rabbit mAb (A19654)

Western blot analysis of extracts of L929, using active + pro Caspase-3 antibody (A19654) at 1:1000 dilution.L929 cells were treated by staurosporine(1 uM) for 3 hour.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.
ABclonal:Western blot - [KO Validated] active + pro Caspase-3 Rabbit mAb (A19654)}

Western blot – [KO Validated] active + pro Caspase-3 Rabbit mAb (A19654)

Western blot analysis of extracts from wild type (WT) and active + pro Caspase 3 knockout (KO) 293T cells, using active+pro Caspase-3 antibody (A19654) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.
ABclonal:Western blot - [KO Validated] active + pro Caspase-3 Rabbit mAb (A19654)}

Western blot – [KO Validated] active + pro Caspase-3 Rabbit mAb (A19654)

Western blot analysis of extracts from wild type(WT) and active + pro Caspase-3 knockout (KO) 293T cells, using active + pro Caspase-3 antibody (A19654) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.
ABclonal:Immunofluorescence - [KO Validated] active + pro Caspase-3 Rabbit mAb (A19654)}

Immunofluorescence – [KO Validated] active + pro Caspase-3 Rabbit mAb (A19654)

Immunofluorescence analysis of HeLa Treated with Etoposide, HeLa cells using [KO Validated] active + pro Caspase-3 Rabbit mAb (A19654) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.

Datasheet

Additional information

CatalogID

A19654-100, A19654-200, A19654-50

Related products