Name: [KO Validated] Bax Rabbit pAb
SKU: [KO Validated] Bax Rabbit pAb - A0207 - ABclonal
Availability: InStock

Description

Overview

Product name	[KO Validated] Bax Rabbit pAb
Catalog No.	A0207
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. The association and the ratio of BAX to BCL2 also determines survival or death of a cell following an apoptotic stimulus. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Bax (NP_620116.1).
Sequence	MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF
Gene ID
Swiss Prot
Synonyms	BCL2L4
Calculated MW	21kDa
Observed MW	21KDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 – 1:1000 IHC-P 1:50 – 1:200 IF/ICC 1:50 – 1:200 IP 1:50 – 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.01% thiomersal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	HT-1080, Raji, 293T
Cellular location	Cytoplasm, Cytoplasm, Mitochondrion membrane, Single-pass membrane protein
Customer validation	(Eoma cell, Human liver cell, Human pancreatic cancer cells, Human skin T cell lymphoma, Hut102, HCT116) WB(Homo sapiens, Rattus norvegicus, Mus musculus, Gallus gallus, Giardia duodenalis, Capra hircus, Ctenopharyngodon, Ctenopharyngodon idellus, lamprey, quails, crab, Mus musculus、Sus scrofa, Coturnix japonica, Bos taurus) IF(Homo sapiens) IHC(Mus musculus, Rattus norvegicus) IHC(Gallus gallus) IP(Mus musculus) IF(Rattus norvegicus) RT-PCR(Homo sapiens)

Research Area

[KO Validated] Bax Rabbit pAb images

Western blot – [KO Validated] Bax Rabbit pAb (A0207)

Western blot analysis of extracts from normal (control) and Bax knockout (KO) 293T cells, using Bax antibody (A0207) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.

Western blot – [KO Validated] Bax Rabbit pAb (A0207)

Western blot analysis of extracts of various cell lines, using Bax antibody (A0207) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.

Western blot – [KO Validated] Bax Rabbit pAb (A0207)

Western blot analysis of extracts of Mouse brain , using Bax antibody (A0207) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.

Immunohistochemistry – [KO Validated] Bax Rabbit pAb (A0207)

Immunohistochemistry of paraffin-embedded mouse spinal cord using [KO Validated] Bax Rabbit pAb (A0207) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.