FREE SHIPPING IN GERMANY ON ORDERS OVER € 500 & € 1000 ACROSS EUROPE!

[KO Validated] APP Rabbit mAb

From: 210.00

SKU: [KO Validated] APP Rabbit mAb - A17911 - ABclonal Category:

Description

Overview

Product name [KO Validated] APP Rabbit mAb
Catalog No. A17911
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0465

This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. In addition, two of the peptides are antimicrobial peptides, having been shown to have bacteriocidal and antifungal activities. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.

Immunogen A synthetic peptide corresponding to a sequence within amino acids 671-770 of human APP (P05067).
Sequence MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
Gene ID
Swiss Prot
Synonyms AAA; AD1; PN2; ABPP; APPI; CVAP; ABETA; PN-II; preA4; CTFgamma; alpha-sAPP
Calculated MW 87kDa
Observed MW 100-140kDa

Reactivity Human, Mouse, Rat
Tested applications WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition
Recommended dilution
  • WB 1:500 – 1:2000
  • IHC-P 1:50 – 1:200
  • IF/ICC 1:50 – 1:200
  • IP 1:500 – 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples HeLa, U-87MG, Mouse brain, Rat brain, 293T
Cellular location Membrane, Single-pass type I membrane protein, clathrin-coated pit
Customer validation

IF(Rattus norvegicus)

WB(Mus musculus, Homo sapiens,Rattus norvegicus)

IF(Mus musculus)

ABclonal:Western blot - [KO Validated] APP Rabbit mAb (A17911)}

Western blot – [KO Validated] APP Rabbit mAb (A17911)

Western blot analysis of extracts from wild type (WT) and APP knockout (KO) 293T cells, using APP antibody (A17911) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.
ABclonal:Western blot - [KO Validated] APP Rabbit mAb (A17911)}

Western blot – [KO Validated] APP Rabbit mAb (A17911)

Western blot analysis of extracts of various cell lines, using APP antibody (A17911) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.
ABclonal:Immunohistochemistry - [KO Validated] APP Rabbit mAb (A17911)}

Immunohistochemistry – [KO Validated] APP Rabbit mAb (A17911)

Immunohistochemistry of paraffin-embedded mouse brain using APP Rabbit mAb (A17911) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KO Validated] APP Rabbit mAb (A17911)}

Immunohistochemistry – [KO Validated] APP Rabbit mAb (A17911)

Immunohistochemistry of paraffin-embedded rat brain using APP Rabbit mAb (A17911) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KO Validated] APP Rabbit mAb (A17911)}

Immunohistochemistry – [KO Validated] APP Rabbit mAb (A17911)

Immunohistochemistry of paraffin-embedded human brain using APP Rabbit mAb (A17911) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - [KO Validated] APP Rabbit mAb (A17911)}

Immunofluorescence – [KO Validated] APP Rabbit mAb (A17911)

Immunofluorescence analysis of HeLa cells using APP Rabbit mAb (A17911) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - [KO Validated] APP Rabbit mAb (A17911)}

Immunoprecipitation – [KO Validated] APP Rabbit mAb (A17911)

Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug APP antibody (A17911). Western blot was performed from the immunoprecipitate using APP antibody (A17911) at a dilution of 1:1000.

* For research use only. Not for therapeutic or diagnostic purposes.

Datasheet

Additional information

CatalogID

A17911-100, A17911-200, A17911-50