Description
Overview
Product name | [KO Validated] APP Rabbit mAb |
---|---|
Catalog No. | A17911 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0465 |
Background
This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. In addition, two of the peptides are antimicrobial peptides, having been shown to have bacteriocidal and antifungal activities. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.
Immunogen information
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 671-770 of human APP (P05067). |
---|---|
Sequence | MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN |
Gene ID | |
Swiss Prot | |
Synonyms | AAA; AD1; PN2; ABPP; APPI; CVAP; ABETA; PN-II; preA4; CTFgamma; alpha-sAPP |
Calculated MW | 87kDa |
Observed MW | 100-140kDa |
Applications
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | HeLa, U-87MG, Mouse brain, Rat brain, 293T |
Cellular location | Membrane, Single-pass type I membrane protein, clathrin-coated pit |
Customer validation |
IF(Rattus norvegicus) WB(Mus musculus, Homo sapiens,Rattus norvegicus) IF(Mus musculus) |
Research Area
- Research Area & PathwaysEpigenetics & Nuclear SignalingTranscription Factors
- Research Area & PathwaysProtein phosphorylation
- Research Area & PathwaysImmunology & InflammationJak-Stat-IL-6 Receptor Signaling Pathway
- Research Area & PathwaysNeuroscienceNeurodegenerative DiseasesAmyloid Plaque and Neurofibrillary Tangle Formation in Alzheimer’s Disease
- Research Area & PathwaysNeuroscienceNeurodegenerative DiseasesNeurodegenerative Diseases Markers
[KO Validated] APP Rabbit mAb images
Western blot analysis of extracts from wild type (WT) and APP knockout (KO) 293T cells, using APP antibody (A17911) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.
Western blot analysis of extracts of various cell lines, using APP antibody (A17911) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.
Immunohistochemistry of paraffin-embedded mouse brain using APP Rabbit mAb (A17911) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded rat brain using APP Rabbit mAb (A17911) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human brain using APP Rabbit mAb (A17911) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of HeLa cells using APP Rabbit mAb (A17911) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug APP antibody (A17911). Western blot was performed from the immunoprecipitate using APP antibody (A17911) at a dilution of 1:1000.
* For research use only. Not for therapeutic or diagnostic purposes.