Description
Overview
| Product name | [KO Validated] LC3B Rabbit mAb |
|---|---|
| Catalog No. | A19665 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC0144 |
Background
The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 2-107 of human LC3B (Q9GZQ8). |
|---|---|
| Sequence | PSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDG |
| Gene ID | |
| Swiss Prot | |
| Synonyms | LC3B; ATG8F; MAP1LC3B-a; MAP1A/1BLC3 |
| Calculated MW | 15kDa |
| Observed MW | 14KDa/16KDa |
Applications
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
| Positive samples | 293T, C6, NIH/3T3 |
| Cellular location | Cytoplasm, Cytoplasmic vesicle, Endomembrane system, Lipid-anchor, autophagosome, autophagosome membrane, cytoskeleton |
| Customer validation |
(Chicken) WB(Mus musculus, Homo sapiens, Rattus norvegicus, Gallus gallus, Human, Sus scrofa, Ctenopharyngodon idellus) IF(Homo sapiens, Mus musculus, Homo sapiens) IHC(Mus musculus, Homo sapiens, Rattus norvegicus) IF(Gallus gallus, Mus musculus, Homo sapiens) WB(Mus musculus, Homo sapiens) IHC(Mus musculus) |
Research Area
[KO Validated] LC3B Rabbit mAb images
![ABclonal:Western blot - [KO Validated] LC3B Rabbit mAb (A19665)}](https://abclonal.com/Uploads/Catalog/A19665/A19665_1.jpg?t=1682492591 "ABclonal:Western blot - [KO Validated] LC3B Rabbit mAb (A19665)")
Western blot analysis of extracts of various lysates, using [KO Validated] LC3B antibody (A19665) at 1:1000 dilution.293T, C6 and NIH/3T3 cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.
![ABclonal:Western blot - [KO Validated] LC3B Rabbit mAb (A19665)}](https://abclonal.com/Uploads/Catalog/A19665/A19665_2.jpg?t=1682492599 "ABclonal:Western blot - [KO Validated] LC3B Rabbit mAb (A19665)")
Western blot analysis of extracts from wild type(WT) and LKB1 knockout (KO) 293T cells, using LKB1 antibody (A19665) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.
![ABclonal:Immunohistochemistry - [KO Validated] LC3B Rabbit mAb (A19665)}](https://abclonal.com/Uploads/Catalog/A19665/A19665_3.jpg?t=1682492619 "ABclonal:Immunohistochemistry - [KO Validated] LC3B Rabbit mAb (A19665)")
Immunohistochemistry of paraffin-embedded human brain using [KO Validated] LC3B Rabbit mAb (A19665) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
![ABclonal:Immunohistochemistry - [KO Validated] LC3B Rabbit mAb (A19665)}](https://abclonal.com/Uploads/Catalog/A19665/A19665_4.jpg?t=1682492641 "ABclonal:Immunohistochemistry - [KO Validated] LC3B Rabbit mAb (A19665)")
Immunohistochemistry of paraffin-embedded rat brain using [KO Validated] LC3B Rabbit mAb (A19665) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
![ABclonal:Immunofluorescence - [KO Validated] LC3B Rabbit mAb (A19665)}](https://abclonal.com/Uploads/Catalog/A19665/A19665_5.jpg?t=1682492649 "ABclonal:Immunofluorescence - [KO Validated] LC3B Rabbit mAb (A19665)")
Immunofluorescence analysis of 293T Treated with Chloroquine and 293T cells using [KO Validated] LC3B Rabbit mAb (A19665) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
![ABclonal:Immunoprecipitation - [KO Validated] LC3B Rabbit mAb (A19665)}](https://abclonal.com/Uploads/Catalog/A19665/A19665_6.jpg?t=1682492654 "ABclonal:Immunoprecipitation - [KO Validated] LC3B Rabbit mAb (A19665)")
Immunoprecipitation analysis of 300ug extracts of 293T cells using 3ug LC3B antibody (A19665). Western blot was performed from the immunoprecipitate using LC3B antibody (A19665) at a dilution of 1:1000.
* For research use only. Not for therapeutic or diagnostic purposes.
