Name: [KO Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb
SKU: [KO Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb - A19062 - ABclonal
Availability: InStock

Description

Overview

Product name	[KO Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb
Catalog No.	A19062
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC53508

Background

Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-265 of human Heme Oxygenase 1 (HO-1/HMOX1) (NP_002124.1).
Sequence	MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQA
Gene ID
Swiss Prot
Synonyms	HO-1; HSP32; HMOX1D; bK286B10
Calculated MW	33kDa
Observed MW	33kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 – 1:10000 IHC-P 1:50 – 1:200 IP 1:500 – 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunoprecipitation
Positive samples	HeLa, HepG2, Raw264.7Mouse spleen, Mouse kidney, Rat kidney
Cellular location	Cytoplasmic side, Endoplasmic reticulum membrane, Microsome, Peripheral membrane protein
Customer validation	WB(Rattus norvegicus, Homo sapiens, Mus musculus, Homo sapiens，Mus musculus)

Research Area

[KO Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb images

Western blot – [KO Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb (A19062)

Western blot analysis of extracts of Raw264.7 cells, using Heme Oxygenase 1 (HO-1/HMOX1) antibody (A19062) at 1:10000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.

Western blot – [KO Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb (A19062)

Western blot analysis of extracts of HepG2 cells, using Heme Oxygenase 1 (HO-1/HMOX1) antibody (A19062) at 1:10000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.

Western blot – [KO Validated] Heme Oxygenase 1 (HO-1/HMOX1) Rabbit mAb (A19062)

Western blot analysis of extracts from wild type(WT) and Heme Oxygenase 1 (HO-1/HMOX1) knockout (KO) HeLa cells, using Heme Oxygenase 1 (HO-1/HMOX1) antibody (A19062) at 1:10000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.