FREE SHIPPING IN GERMANY ON ORDERS OVER € 500 & € 1000 ACROSS EUROPE!

[KO Validated] SQSTM1/p62 Rabbit mAb

From: €210.00

SKU: [KO Validated] SQSTM1/p62 Rabbit mAb - A19700 - ABclonal Category:

Description

Overview

Product name [KO Validated] SQSTM1/p62 Rabbit mAb
Catalog No. A19700
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0180

This gene encodes a multifunctional protein that binds ubiquitin and regulates activation of the nuclear factor kappa-B (NF-kB) signaling pathway. The protein functions as a scaffolding/adaptor protein in concert with TNF receptor-associated factor 6 to mediate activation of NF-kB in response to upstream signals. Alternatively spliced transcript variants encoding either the same or different isoforms have been identified for this gene. Mutations in this gene result in sporadic and familial Paget disease of bone.

Immunogen A synthetic peptide corresponding to a sequence within amino acids 341-440 of human SQSTM1/p62 (Q13501).
Sequence LSSKEVDPSTGELQSLQMPESEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDTIQYSKHPPPL
Gene ID
Swiss Prot
Synonyms p60; p62; A170; DMRV; OSIL; PDB3; ZIP3; p62B; NADGP; FTDALS3
Calculated MW 48kDa
Observed MW 62KDa

Reactivity Human, Mouse, Rat
Tested applications WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition
Recommended dilution
  • WB 1:500 – 1:1000
  • IHC-P 1:50 – 1:200
  • IF/ICC 1:50 – 1:200
  • IP 1:500 – 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples 293T, HeLa, L929, C2C12, PC-12
Cellular location Cytoplasm, Cytoplasmic vesicle, Endoplasmic reticulum, Late endosome, Lysosome, Nucleus, P-body, autophagosome
Customer validation

(HeLa、PC-3、U2-OS、293T)

WB(Mus musculus, Homo sapiens, Rattus norvegicus, Gallus gallus, Sus scrofa, Human)

IHC(Mus musculus)

IF(Homo sapiens, Sus scrofa, Mus musculus)

IF(Mus musculus,Homo sapiens)

WB(Mus musculus,Homo sapiens)

IP(Mus musculus)

ABclonal:Western blot - [KO Validated] SQSTM1/p62 Rabbit mAb (A19700)}

Western blot – [KO Validated] SQSTM1/p62 Rabbit mAb (A19700)

Western blot analysis of extracts of various cell lines, using SQSTM1/p62 antibody (A19700) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.
ABclonal:Western blot - [KO Validated] SQSTM1/p62 Rabbit mAb (A19700)}

Western blot – [KO Validated] SQSTM1/p62 Rabbit mAb (A19700)

Western blot analysis of extracts of PC-12 cells, using SQSTM1/p62 antibody (A19700) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.
ABclonal:Western blot - [KO Validated] SQSTM1/p62 Rabbit mAb (A19700)}

Western blot – [KO Validated] SQSTM1/p62 Rabbit mAb (A19700)

Western blot analysis of extracts of HeLa cells, using SQSTM1/p62 antibody (A19700) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.
ABclonal:Immunohistochemistry - [KO Validated] SQSTM1/p62 Rabbit mAb (A19700)}

Immunohistochemistry – [KO Validated] SQSTM1/p62 Rabbit mAb (A19700)

Immunohistochemistry of paraffin-embedded rat spleen using [KO Validated] SQSTM1/p62 Rabbit mAb (A19700) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KO Validated] SQSTM1/p62 Rabbit mAb (A19700)}

Immunohistochemistry – [KO Validated] SQSTM1/p62 Rabbit mAb (A19700)

Immunohistochemistry of paraffin-embedded human lung cancer using [KO Validated] SQSTM1/p62 Rabbit mAb (A19700) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KO Validated] SQSTM1/p62 Rabbit mAb (A19700)}

Immunohistochemistry – [KO Validated] SQSTM1/p62 Rabbit mAb (A19700)

Immunohistochemistry of paraffin-embedded mouse spleen using [KO Validated] SQSTM1/p62 Rabbit mAb (A19700) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - [KO Validated] SQSTM1/p62 Rabbit mAb (A19700)}

Immunofluorescence – [KO Validated] SQSTM1/p62 Rabbit mAb (A19700)

Confocal imaging of HeLa cells using [KO Validated] SQSTM1/p62 Rabbit mAb (A19700, dilution 1:200) (Red). The cells were counterstained with Alpha-tubulin (ubiquitous) chain Rabbit mAb (AC039, dilution 1:100) (Green). DAPI was used for nuclear staining (Blue). Objective: 60x.
ABclonal:Immunoprecipitation - [KO Validated] SQSTM1/p62 Rabbit mAb (A19700)}

Immunoprecipitation – [KO Validated] SQSTM1/p62 Rabbit mAb (A19700)

Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug SQSTM1/p62 Rabbit mAb (A19700). Western blot was performed from the immunoprecipitate using SQSTM1/p62 Rabbit mAb (A19700) at a dilition of 1:1000.

* For research use only. Not for therapeutic or diagnostic purposes.

Datasheet

Additional information

CatalogID

A19700-100, A19700-200, A19700-50

Related products