FREE SHIPPING IN GERMANY ON ORDERS OVER € 500 & € 1000 ACROSS EUROPE!

[KO Validated] Cytochrome C Rabbit mAb

From: €210.00

SKU: [KO Validated] Cytochrome C Rabbit mAb - A4912 - ABclonal Category:

Description

Overview

Product name [KO Validated] Cytochrome C Rabbit mAb
Catalog No. A4912
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC1153

This gene encodes a small heme protein that functions as a central component of the electron transport chain in mitochondria. The encoded protein associates with the inner membrane of the mitochondrion where it accepts electrons from cytochrome b and transfers them to the cytochrome oxidase complex. This protein is also involved in initiation of apoptosis. Mutations in this gene are associated with autosomal dominant nonsyndromic thrombocytopenia. Numerous processed pseudogenes of this gene are found throughout the human genome.

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-105 of human Cytochrome C (P99999).
Sequence MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
Gene ID
Swiss Prot
Synonyms CYC; HCS; THC4
Calculated MW 12kDa
Observed MW 14KDa

Reactivity Human, Mouse, Rat
Tested applications WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition
Recommended dilution
  • WB 1:500 – 1:1000
  • IHC-P 1:50 – 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application Western blotting    Immunohistochemistry    
Positive samples HeLa, 293T, Mouse brain, Mouse kidney, Mouse heart, Rat brain, Rat kidney
Cellular location Mitochondrion intermembrane space
Customer validation

WB(Homo sapiens, lamprey, Mus musculus, Rattus norvegicus, Plagiomnium acutum)

IF(Homo sapiens, Plagiomnium acutum)

ABclonal:Western blot - [KO Validated] Cytochrome C Rabbit mAb (A4912)}

Western blot – [KO Validated] Cytochrome C Rabbit mAb (A4912)

Western blot analysis of extracts of various cell lines, using Cytochrome C Rabbit mAb (A4912) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.
ABclonal:Western blot - [KO Validated] Cytochrome C Rabbit mAb (A4912)}

Western blot – [KO Validated] Cytochrome C Rabbit mAb (A4912)

Western blot analysis of extracts from wild type (WT) and Cytochrome C knockout (KO) 293T cells, using Cytochrome C antibody (A4912) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.
ABclonal:Immunohistochemistry - [KO Validated] Cytochrome C Rabbit mAb (A4912)}

Immunohistochemistry – [KO Validated] Cytochrome C Rabbit mAb (A4912)

Immunohistochemistry of paraffin-embedded rat kidney using Cytochrome C Rabbit mAb (A4912) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KO Validated] Cytochrome C Rabbit mAb (A4912)}

Immunohistochemistry – [KO Validated] Cytochrome C Rabbit mAb (A4912)

Immunohistochemistry of paraffin-embedded human appendix using Cytochrome C Rabbit mAb (A4912) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

* For research use only. Not for therapeutic or diagnostic purposes.

Datasheet

Additional information

CatalogID

A4912-100, A4912-200, A4912-50

Related products