Description
Overview
| Product name | OTX2 Rabbit pAb |
|---|---|
| Catalog No. | A5475 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
This gene encodes a member of the bicoid subfamily of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and plays a role in brain, craniofacial, and sensory organ development. The encoded protein also influences the proliferation and differentiation of dopaminergic neuronal progenitor cells during mitosis. Mutations in this gene cause syndromic microphthalmia 5 (MCOPS5) and combined pituitary hormone deficiency 6 (CPHD6). This gene is also suspected of having an oncogenic role in medulloblastoma. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Pseudogenes of this gene are known to exist on chromosomes two and nine.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 140-280 of human OTX2 (NP_068374.1). |
|---|---|
| Sequence | TPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMDCGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGFNSTTDCLDYKDQTASWKLNFNA |
| Gene ID | |
| Swiss Prot | |
| Synonyms | CPHD6; MCOPS5 |
| Calculated MW | 32kDa |
| Observed MW | 32kDa |
Applications
| Reactivity | Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | Mouse liver, Mouse brain |
| Cellular location | Nucleus |
Research Area
OTX2 Rabbit pAb images
Western blot analysis of extracts of various cell lines, using OTX2 antibody (A5475) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25ug per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 60s.
* For research use only. Not for therapeutic or diagnostic purposes.
