Description
Overview
| Product name | [KO Validated] Smad3 Rabbit mAb |
|---|---|
| Catalog No. | A19115 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC53861 |
Background
The SMAD family of proteins are a group of intracellular signal transducer proteins similar to the gene products of the Drosophila gene ‘mothers against decapentaplegic’ (Mad) and the C. elegans gene Sma. The SMAD3 protein functions in the transforming growth factor-beta signaling pathway, and transmits signals from the cell surface to the nucleus, regulating gene activity and cell proliferation. This protein forms a complex with other SMAD proteins and binds DNA, functioning both as a transcription factor and tumor suppressor. Mutations in this gene are associated with aneurysms-osteoarthritis syndrome and Loeys-Dietz Syndrome 3.
Immunogen information
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Smad3 (NP_005893.1). |
|---|---|
| Sequence | HHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSM |
| Gene ID | |
| Swiss Prot | |
| Synonyms | LDS3; mad3; LDS1C; MADH3; JV15-2; hMAD-3; hSMAD3; HSPC193; HsT17436 |
| Calculated MW | 48kDa |
| Observed MW | 52KDa |
Applications
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunoprecipitation |
| Positive samples | A-549, C2C12, Rat testis, HCT116 |
| Cellular location | Cytoplasm, Nucleus |
| Customer validation |
WB(Mus musculus, Rattus norvegicus, Homo sapiens, Homo sapiens、Mus musculus) IHC(Homo sapiens) IB，IP(Homo sapiens) |
Research Area
- Research Area & PathwaysEpigenetics & Nuclear SignalingTranscription Factors
- Research Area & PathwaysProtein phosphorylation
- Research Area & PathwaysCell Biology & Developmental BiologyCell CycleCell Cycle Control-G1/S Checkpoint
- Research Area & PathwaysCell Biology & Developmental BiologyESC Pluripotency and Differentiation
- Research Area & PathwaysCell Biology & Developmental BiologyTGF-b-Smad Signaling PathwaySMADs
[KO Validated] Smad3 Rabbit mAb images
![ABclonal:Western blot - [KO Validated] Smad3 Rabbit mAb (A19115)}](https://abclonal.com/Uploads/Catalog/A19115/A19115_1.jpg?t=1683355006 "ABclonal:Western blot - [KO Validated] Smad3 Rabbit mAb (A19115)")
Western blot analysis of various lysates, using Smad3 Rabbit mAb (A19115) at 1:20000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.
![ABclonal:Western blot - [KO Validated] Smad3 Rabbit mAb (A19115)}](https://abclonal.com/Uploads/Catalog/A19115/A19115_2.jpg?t=1683355015 "ABclonal:Western blot - [KO Validated] Smad3 Rabbit mAb (A19115)")
Western blot analysis of Rat testis, using Smad3 Rabbit mAb (A19115) at 1:20000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.
![ABclonal:Western blot - [KO Validated] Smad3 Rabbit mAb (A19115)}](https://abclonal.com/Uploads/Catalog/A19115/A19115_3.jpg?t=1683355023 "ABclonal:Western blot - [KO Validated] Smad3 Rabbit mAb (A19115)")
Western blot analysis of extracts from wild type(WT) and Smad3 Rabbit mAb knockout (KO) HCT116(KO) cells, using Smad3 Rabbit mAb (A19115) at 1:20000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.
![ABclonal:Immunohistochemistry - [KO Validated] Smad3 Rabbit mAb (A19115)}](https://abclonal.com/Uploads/Catalog/A19115/A19115_4.jpg?t=1683355043 "ABclonal:Immunohistochemistry - [KO Validated] Smad3 Rabbit mAb (A19115)")
Immunohistochemistry of paraffin-embedded human testis using [KO Validated] Smad3 Rabbit mAb (A19115) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
![ABclonal:Immunohistochemistry - [KO Validated] Smad3 Rabbit mAb (A19115)}](https://abclonal.com/Uploads/Catalog/A19115/A19115_5.jpg?t=1683355056 "ABclonal:Immunohistochemistry - [KO Validated] Smad3 Rabbit mAb (A19115)")
Immunohistochemistry of paraffin-embedded human tonsil using [KO Validated] Smad3 Rabbit mAb (A19115) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
* For research use only. Not for therapeutic or diagnostic purposes.
