Description
Overview
| Product name | CALD1 Rabbit pAb |
|---|---|
| Catalog No. | A5366 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
This gene encodes a calmodulin- and actin-binding protein that plays an essential role in the regulation of smooth muscle and nonmuscle contraction. The conserved domain of this protein possesses the binding activities to Ca(2+)-calmodulin, actin, tropomyosin, myosin, and phospholipids. This protein is a potent inhibitor of the actin-tropomyosin activated myosin MgATPase, and serves as a mediating factor for Ca(2+)-dependent inhibition of smooth muscle contraction. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human CALD1 (NP_004333.1). |
|---|---|
| Sequence | MDDFERRRELRRQKREEMRLEAERIAYQRNDDDEEEAARERRRRARQERLRQKQEEESLGQVTDQVEVNAQNSVPDEEAKTTTTNTQVEGDDEAAFLERLARREERRQKRLQEALERQKEFDPTITDASLSLPSRRMQNDTAENETTEKEEKSESRQERYEIEETETVTKSYQKNDWRDAEENKKEDKEKEEEEEEKPKRGSIGENQIKDEKIKKDKEPKEEVKSFMDRKKGFTEVKSQN |
| Gene ID | |
| Swiss Prot | |
| Synonyms | CDM; HCAD; LCAD; h-CD; H-CAD; L-CAD; NAG22 |
| Calculated MW | 93kDa |
| Observed MW | 93KDa |
Applications
| Reactivity | Human |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | A-431 |
| Cellular location | Cytoplasm, cytoskeleton, myofibril |
Research Area
CALD1 Rabbit pAb images
Western blot analysis of A-431, using CALD1 Rabbit pAb (A5366) at 1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 180s.
* For research use only. Not for therapeutic or diagnostic purposes.
