Description
Overview
| Product name | CHRM5 Rabbit pAb |
|---|---|
| Catalog No. | A5367 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The clinical implications of this receptor are unknown; however, stimulation of this receptor is known to increase cyclic AMP levels.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 275-370 of human CHRM5 (NP_036257.1). |
|---|---|
| Sequence | RRSTSTTGKPSQATGPSANWAKAEQLTTCSSYPSSEDEDKPATDPVLQVVYKSQGKESPGEEFSAEETEETFVKAETEKSDYDTPNYLLSPAAAHR |
| Gene ID | |
| Swiss Prot | |
| Synonyms | HM5 |
| Calculated MW | 60kDa |
| Observed MW | 60KDa |
Applications
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | Mouse spinal cord |
| Cellular location | Cell junction, Cell membrane, Multi-pass membrane protein, postsynaptic cell membrane, synapse |
Research Area
CHRM5 Rabbit pAb images
Western blot analysis of extracts of Mouse spinal cord, using CHRM5 antibody (A5367) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.
* For research use only. Not for therapeutic or diagnostic purposes.
