Description
Overview
| Product name | [KO Validated] Cyclin B1 Rabbit mAb |
|---|---|
| Catalog No. | A19037 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC0474 |
Background
The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). The encoded protein is necessary for proper control of the G2/M transition phase of the cell cycle.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 3-177 of human Cyclin B1 (P14635). |
|---|---|
| Sequence | LRVTRNSKINAENKAKINMAGAKRVPTAPAATSKPGLRPRTALGDIGNKVSEQLQAKMPMKKEAKPSATGKVIDKKLPKPLEKVPMLVPVPVSEPVPEPEPEPEPEPVKEEKLSPEPILVDTASPSPMETSGCAPAEEDLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAY |
| Gene ID | |
| Swiss Prot | |
| Synonyms | CCNB |
| Calculated MW | 48kDa |
| Observed MW | 55kDa |
Applications
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | Jurkat, Mouse testis, HeLa |
| Cellular location | Cytoplasm, Nucleus, centrosome, cytoskeleton, microtubule organizing center |
| Customer validation |
IHC(Homo sapiens,Mus musculus) IF(Homo sapiens,Mus musculus) WB(Homo sapiens, Mus musculus) |
Research Area
- Research Area & PathwaysSignal TransductionATM Signaling Pathway
- Research Area & PathwaysCell Biology & Developmental BiologyCell CycleCentrosome
- Research Area & PathwaysCell Biology & Developmental BiologyCell CycleCyclins
- Research Area & PathwaysCell Biology & Developmental BiologyCell CycleCell Cycle Control-G2/M DNA Damage Checkpoint
- Research Area & PathwaysEndocrine & MetabolismAMPK Signaling Pathway
[KO Validated] Cyclin B1 Rabbit mAb images
![ABclonal:Western blot - [KO Validated] Cyclin B1 Rabbit mAb (A19037)}](https://abclonal.com/Uploads/Catalog/A19037/A19037_1.jpg?t=1675040264 "ABclonal:Western blot - [KO Validated] Cyclin B1 Rabbit mAb (A19037)")
Western blot analysis of extracts from wild type (WT) and Cyclin B1 knockout (KO) HeLa cells, using Cyclin B1 antibody (A19037) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.
![ABclonal:Western blot - [KO Validated] Cyclin B1 Rabbit mAb (A19037)}](https://abclonal.com/Uploads/Catalog/A19037/A19037_2.jpg?t=1675040270 "ABclonal:Western blot - [KO Validated] Cyclin B1 Rabbit mAb (A19037)")
Western blot analysis of extracts of various cell lines, using Cyclin B1 antibody (A19037) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3min.
* For research use only. Not for therapeutic or diagnostic purposes.
