Description
Overview
| Product name | CTSH Rabbit pAb |
|---|---|
| Catalog No. | A5368 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
The protein encoded by this gene is a lysosomal cysteine proteinase important in the overall degradation of lysosomal proteins. It is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor. The encoded protein, which belongs to the peptidase C1 protein family, can act both as an aminopeptidase and as an endopeptidase. Increased expression of this gene has been correlated with malignant progression of prostate tumors. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 23-140 of human CTSH (NP_004381.2). |
|---|---|
| Sequence | AELCVNSLEKFHFKSWMSKHRKTYSTEEYHHRLQTFASNWRKINAHNNGNHTFKMALNQFSDMSFAEIKHKYLWSEPQNCSATKSNYLRGTGPYPPSVDWRKKGNFVSPVKNQGACGS |
| Gene ID | |
| Swiss Prot | |
| Synonyms | ACC4; ACC5; CPSB; ACC-4; ACC-5 |
| Calculated MW | 37kDa |
| Observed MW | 41KDa |
Applications
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | HepG2, A-549, Mouse liver, Mouse kidney, Rat liver, Rat kidney |
| Cellular location | Lysosome |
Research Area
CTSH Rabbit pAb images
Western blot analysis of extracts of various cell lines, using CTSH antibody (A5368) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.
* For research use only. Not for therapeutic or diagnostic purposes.
