FREE SHIPPING IN GERMANY ON ORDERS OVER € 500 & € 1000 ACROSS EUROPE!

[KO Validated] Vimentin Rabbit mAb

From: €210.00

SKU: [KO Validated] Vimentin Rabbit mAb - A19607 - ABclonal Category:

Description

Overview

Product name [KO Validated] Vimentin Rabbit mAb
Catalog No. A19607
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0086

This gene encodes a type III intermediate filament protein. Intermediate filaments, along with microtubules and actin microfilaments, make up the cytoskeleton. The encoded protein is responsible for maintaining cell shape and integrity of the cytoplasm, and stabilizing cytoskeletal interactions. This protein is involved in neuritogenesis and cholesterol transport and functions as an organizer of a number of other critical proteins involved in cell attachment, migration, and signaling. Bacterial and viral pathogens have been shown to attach to this protein on the host cell surface. Mutations in this gene are associated with congenital cataracts in human patients.

Immunogen A synthetic peptide corresponding to a sequence within amino acids 367-466 of human Vimentin (P08670).
Sequence DEIQNMKEEMARHLREYQDLLNVKMALDIEIATYRKLLEGEESRISLPLPNFSSLNLRETNLDSLPLVDTHSKRTLLIKTVETRDGQVINETSQHHDDLE
Gene ID
Swiss Prot
Synonyms CTRCT30; HEL113; Vimentin; VIM; vimentin
Calculated MW 54kDa
Observed MW 54kDa

Reactivity Human, Mouse, Rat
Tested applications WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition
Recommended dilution
  • WB 1:500 – 1:1000
  • IHC-P 1:50 – 1:200
  • IF/ICC 1:50 – 1:200
  • IP 1:500 – 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples 293T, Jurkat, HeLa, Mouse testis, C6
Cellular location Cytoplasm
Customer validation

WB(Homo sapiens, Mus musculus, Rattus norvegicus, Chlorocebus aethiops)

IF(Mus musculus)

IHC(Homo sapiens, Mus musculus)

IF(Mus musculus, Homo sapiens)

IF(Homo sapiens, Mus musculus)

WB，IF，IHC(Mus musculus)

WB(Homo sapiens,Mus musculus)

ABclonal:Western blot - [KO Validated] Vimentin Rabbit mAb (A19607)}

Western blot – [KO Validated] Vimentin Rabbit mAb (A19607)

Western blot analysis of extracts of various cell lines, using Vimentin antibody (A19607) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.
ABclonal:Western blot - [KO Validated] Vimentin Rabbit mAb (A19607)}

Western blot – [KO Validated] Vimentin Rabbit mAb (A19607)

Western blot analysis of extracts from wild type (WT) and Vimentin knockout (KO) 293T cells, using Vimentin antibody (A19607) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.
ABclonal:Immunohistochemistry - [KO Validated] Vimentin Rabbit mAb (A19607)}

Immunohistochemistry – [KO Validated] Vimentin Rabbit mAb (A19607)

Immunohistochemistry of paraffin-embedded Human liver using Vimentin antibody (A19607) at dilution of 1:50(40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KO Validated] Vimentin Rabbit mAb (A19607)}

Immunohistochemistry – [KO Validated] Vimentin Rabbit mAb (A19607)

Immunohistochemistry of paraffin-embedded Human colon carcinoma using Vimentin antibody (A19607) at dilution of 1:50(40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KO Validated] Vimentin Rabbit mAb (A19607)}

Immunohistochemistry – [KO Validated] Vimentin Rabbit mAb (A19607)

Immunohistochemistry of paraffin-embedded Human kidney using Vimentin antibody (A19607) at dilution of 1:50(40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - [KO Validated] Vimentin Rabbit mAb (A19607)}

Immunofluorescence – [KO Validated] Vimentin Rabbit mAb (A19607)

Confocal Immunofluorescence analysis of U2OS cells using KRR1 Rabbit pAb (A4487) at dilution of 1:100 (40x lens)(red). Vimentin (A19607: Vimentin Rabbit mAb) for Cytoskeleton staining(green), DAPI for nuclear staining(blue).
ABclonal:Immunofluorescence - [KO Validated] Vimentin Rabbit mAb (A19607)}

Immunofluorescence – [KO Validated] Vimentin Rabbit mAb (A19607)

Confocal imaging of HeLa cells using [KO Validated] Vimentin Rabbit mAb (A19607, dilution 1:100) (Green). The cells were counterstained with Aurora B Rabbit mAb (A19539, dilution 1:800) (Red). DAPI was used for nuclear staining (blue). Objective: 60x.
ABclonal:Immunoprecipitation - [KO Validated] Vimentin Rabbit mAb (A19607)}

Immunoprecipitation – [KO Validated] Vimentin Rabbit mAb (A19607)

Immunoprecipitation analysis of 300ug extracts of Jurkat cells using 3ug Vimentin antibody (A19607). Western blot was performed from the immunoprecipitate using Vimentin antibody (A19607) at a dilution of 1:1000.

* For research use only. Not for therapeutic or diagnostic purposes.

Datasheet

Additional information

CatalogID

A19607-100, A19607-200, A19607-50

Related products