Description
Overview
| Product name | [KO Validated] p38 MAPK Rabbit mAb |
|---|---|
| Catalog No. | A4771 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC0201 |
Background
The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Immunogen information
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human p38 MAPK (Q16539). |
|---|---|
| Sequence | NDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHY |
| Gene ID | |
| Swiss Prot | |
| Synonyms | RK; p38; CSBP; EXIP; Mxi2; CSBP1; CSBP2; CSPB1; PRKM14; PRKM15; SAPK2A; p38ALPHA |
| Calculated MW | 41kDa |
| Observed MW | 40KDa |
Applications
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | HeLa, 293T, PC-12, NIH/3T3, Jurkat, Mouse liver, Mouse kidney, Rat heart |
| Cellular location | Cytoplasm, Nucleus |
| Customer validation |
WB(Rattus norvegicus, Mus musculus, Homo sapiens, Homo sapiens，Rattus norvegicus) |
Research Area
- Research Area & PathwaysEpigenetics & Nuclear SignalingTranslation ControlRegulation of eIF4 and p70 S6 Kinase
- Research Area & PathwaysProtein phosphorylation
- Research Area & PathwaysSignal TransductionKinaseSerine/threonine kinases
- Research Area & PathwaysSignal TransductionPhospholipase Signaling Pathway
- Research Area & PathwaysSignal TransductionErbB-HER Signaling Pathway
- Research Area & PathwaysSignal TransductionMAPK-P38 Signaling Pathway
- Research Area & PathwaysSignal TransductionATM Signaling Pathway
- Research Area & PathwaysImmunology & InflammationB Cell Receptor Signaling Pathway
- Research Area & PathwaysImmunology & InflammationT Cell Receptor Signaling Pathway
- Research Area & PathwaysImmunology & InflammationNF-kB Signaling Pathway
- Research Area & PathwaysImmunology & InflammationToll-like Receptor Signaling Pathway
- Research Area & PathwaysImmunology & InflammationCell Intrinsic Innate Immunity Signaling PathwayTLR Signaling
[KO Validated] p38 MAPK Rabbit mAb images
![ABclonal:Western blot - [KO Validated] p38 MAPK Rabbit mAb (A4771)}](https://abclonal.com/Uploads/Catalog/A4771/A4771_1.jpg?t=1679646829 "ABclonal:Western blot - [KO Validated] p38 MAPK Rabbit mAb (A4771)")
Western blot analysis of extracts of various cell lines, using p38 MAPK Rabbit mAb (A4771) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1min.
![ABclonal:Western blot - [KO Validated] p38 MAPK Rabbit mAb (A4771)}](https://abclonal.com/Uploads/Catalog/A4771/A4771_2.jpg?t=1679646835 "ABclonal:Western blot - [KO Validated] p38 MAPK Rabbit mAb (A4771)")
Western blot analysis of extracts from wild type(WT) and p38 MAPK knockout (KO) HeLa cells, using p38 MAPK antibody (A4771) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.
* For research use only. Not for therapeutic or diagnostic purposes.
