Description
Overview
| Product name | CYB5B Rabbit pAb |
|---|---|
| Catalog No. | A15900 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
Enables heme binding activity. Contributes to nitrite reductase (NO-forming) activity. Involved in nitric oxide biosynthetic process. Located in membrane. Part of nitric-oxide synthase complex.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 16-150 of human CYB5B (NP_085056.2). |
|---|---|
| Sequence | KGQEVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKDPSKNDTCKSCWAYWILPIIGAVLLGFLYRYYTSESKSS |
| Gene ID | |
| Swiss Prot | |
| Synonyms | OMB5; CYB5-M; CYPB5M |
| Calculated MW | 17kDa |
| Observed MW | 20kDa |
Applications
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.01% thiomersal, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | Raji, HeLa, LO2, Mouse thymus, Mouse brain, Mouse heart |
| Cellular location | Mitochondrion outer membrane |
Research Area
CYB5B Rabbit pAb images
Western blot analysis of extracts of various cell lines, using CYB5B antibody (A15900) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.
* For research use only. Not for therapeutic or diagnostic purposes.
![[KO Validated] β-Catenin Rabbit mAb](https://zellbio.eu/wp-content/uploads/2022/02/ABclonal_ZellBio-300x300.jpg "[KO Validated] β-Catenin Rabbit mAb")