FREE SHIPPING IN GERMANY ON ORDERS OVER € 500 & € 1000 ACROSS EUROPE!

[KO Validated] β-Catenin Rabbit mAb

From: €210.00

SKU: [KO Validated] β-Catenin Rabbit mAb - A19657 - ABclonal Category:

Description

Overview

Product name [KO Validated] β-Catenin Rabbit mAb
Catalog No. A19657
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0136

The protein encoded by this gene is part of a complex of proteins that constitute adherens junctions (AJs). AJs are necessary for the creation and maintenance of epithelial cell layers by regulating cell growth and adhesion between cells. The encoded protein also anchors the actin cytoskeleton and may be responsible for transmitting the contact inhibition signal that causes cells to stop dividing once the epithelial sheet is complete. Finally, this protein binds to the product of the APC gene, which is mutated in adenomatous polyposis of the colon. Mutations in this gene are a cause of colorectal cancer (CRC), pilomatrixoma (PTR), medulloblastoma (MDB), and ovarian cancer. Alternative splicing results in multiple transcript variants.

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human beta Catenin (P35222).
Sequence MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFP
Gene ID
Swiss Prot
Synonyms EVR7; CTNNB; MRD19; NEDSDV; armadillo
Calculated MW 85kDa
Observed MW 92kDa

Reactivity Human, Mouse, Rat
Tested applications WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition
Recommended dilution
  • WB 1:500 – 1:2000
  • IHC-P 1:50 – 1:200
  • IF/ICC 1:50 – 1:200
  • IP 1:500 – 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples HeLa, Mouse brain, 293T
Cellular location Cell junction, Cell membrane, Cytoplasm, Nucleus, adherens junction, centrosome, cytoskeleton, microtubule organizing center, spindle pole
Customer validation

(normal mouse hippocampus)

WB(Homo sapiens, Rattus norvegicus, Mus musculus)

IF(Homo sapiens, Mus musculus)

IHC(Homo sapiens, Mus musculus)

IF(Mus musculus, Homo sapiens)

IF(Homo sapiens, Mus musculus, Rattus norvegicus)

WB(Mus musculus)

Western Blot(Mus musculus)

IHC(Homo sapiens, Rattus norvegicus)

RT-qPCR(Rattus norvegicus)

ABclonal:Western blot - [KO Validated] β-Catenin Rabbit mAb (A19657)}

Western blot – [KO Validated] β-Catenin Rabbit mAb (A19657)

Western blot analysis of extracts of HeLa cells, using β-Catenin antibody (A19657) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.
ABclonal:Western blot - [KO Validated] β-Catenin Rabbit mAb (A19657)}

Western blot – [KO Validated] β-Catenin Rabbit mAb (A19657)

Western blot analysis of extracts of Mouse brain, using β-Catenin antibody (A19657) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.
ABclonal:Western blot - [KO Validated] β-Catenin Rabbit mAb (A19657)}

Western blot – [KO Validated] β-Catenin Rabbit mAb (A19657)

Western blot analysis of extracts from wild type (WT) and β-Catenin knockout (KO) 293T cells, using β-Catenin antibody (A19657) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.
ABclonal:Immunohistochemistry - [KO Validated] β-Catenin Rabbit mAb (A19657)}

Immunohistochemistry – [KO Validated] β-Catenin Rabbit mAb (A19657)

Immunohistochemistry of paraffin-embedded human breast cancer using β-Catenin Rabbit mAb (A19657) at dilution of 1:50(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KO Validated] β-Catenin Rabbit mAb (A19657)}

Immunohistochemistry – [KO Validated] β-Catenin Rabbit mAb (A19657)

Immunohistochemistry of paraffin-embedded human pancreas using β-Catenin Rabbit mAb (A19657) at dilution of 1:50(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KO Validated] β-Catenin Rabbit mAb (A19657)}

Immunohistochemistry – [KO Validated] β-Catenin Rabbit mAb (A19657)

Immunohistochemistry of paraffin-embedded human small cell lung cancer using β-Catenin Rabbit mAb (A19657) at dilution of 1:50(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - [KO Validated] β-Catenin Rabbit mAb (A19657)}

Immunofluorescence – [KO Validated] β-Catenin Rabbit mAb (A19657)

Immunofluorescence analysis of C6 using [KO Validated] β-Catenin Rabbit mAb (A19657) at dilution of 100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - [KO Validated] β-Catenin Rabbit mAb (A19657)}

Immunoprecipitation – [KO Validated] β-Catenin Rabbit mAb (A19657)

Immunoprecipitation analysis of 600ug extracts of Mouse brain using 3ug β-Catenin antibody (A19657). Western blot was performed from the immunoprecipitate using β-Catenin (A19657) at a dilution of 1:1000.

* For research use only. Not for therapeutic or diagnostic purposes.

Datasheet

Additional information

CatalogID

A19657-100, A19657-200, A19657-50

Related products