Description
Overview
| Product name | DP1/TFDP1 Rabbit pAb |
|---|---|
| Catalog No. | A5422 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
This gene encodes a member of a family of transcription factors that heterodimerize with E2F proteins to enhance their DNA-binding activity and promote transcription from E2F target genes. The encoded protein functions as part of this complex to control the transcriptional activity of numerous genes involved in cell cycle progression from G1 to S phase. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 1, 15, and X.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human DP1/TFDP1 (NP_009042.1). |
|---|---|
| Sequence | MAKDAGLIEANGELKVFIDQNLSPGKGVVSLVAVHPSTVNPLGKQLLPKTFGQSNVNIAQQVVIGTPQRPAASNTLVVGSPHTPSTHFASQNQPSDSSPWSAGKRNRKGEKNGKGLRHFSMKVCEKVQRKGTTSYNEVADELVAEFSAADNHILPNESAY |
| Gene ID | |
| Swiss Prot | |
| Synonyms | DP1; DILC; Dp-1; DRTF1 |
| Calculated MW | 45kDa |
| Observed MW | 45kDa |
Applications
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.01% thiomersal, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | LO2, Raji, Mouse kidney |
| Cellular location | Nucleus |
Research Area
DP1/TFDP1 Rabbit pAb images
Western blot analysis of extracts of various cell lines, using DP1/DP1/TFDP1 antibody (A5422) at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.
Immunohistochemistry of paraffin-embedded human colon damage using DP1/DP1/TFDP1 antibody (A5422) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human lung using DP1/DP1/TFDP1 antibody (A5422) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
* For research use only. Not for therapeutic or diagnostic purposes.
