Description
Overview
| Product name | EPAS1/HIF2α Rabbit pAb |
|---|---|
| Catalog No. | A7553 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
This gene encodes a transcription factor involved in the induction of genes regulated by oxygen, which is induced as oxygen levels fall. The encoded protein contains a basic-helix-loop-helix domain protein dimerization domain as well as a domain found in proteins in signal transduction pathways which respond to oxygen levels. Mutations in this gene are associated with erythrocytosis familial type 4.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 678-745 of human EPAS1/HIF2α (NP_001421.2). |
|---|---|
| Sequence | TFKTRSAKGFGARGPDVLSPAMVALSNKLKLKRQLEYEEQAFQDLSGGDPPGGSTSHLMWKRMKNLRG |
| Gene ID | |
| Swiss Prot | |
| Synonyms | HLF; MOP2; ECYT4; HIF2A; PASD2; bHLHe73 |
| Calculated MW | 96kDa |
| Observed MW | 120kDa |
Applications
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | HepG2, NIH/3T3 |
| Cellular location | Nucleus, Nucleus speckle |
| Customer validation |
WB(Homo sapiens, Mus musculus, Rattus norvegicus) IF(Mus musculus) IHC(Homo sapiens) |
Research Area
- Research Area & PathwaysEpigenetics & Nuclear SignalingTranscription Factors
- Research Area & PathwaysCancerInvasion and Metastasis
- Research Area & PathwaysEndocrine & MetabolismNucleotide metabolismMolecular processes
- Research Area & PathwaysCardiovascularHypoxiaHIF
- Research Area & PathwaysCell Biology & Developmental BiologyFerroptosis
EPAS1/HIF2α Rabbit pAb images
Western blot analysis of extracts of various cell lines, using EPAS1/HIF2α antibody (A7553) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.
Immunohistochemistry of paraffin-embedded human thyroid cancer using EPAS1/HIF2α Rabbit pAb (A7553) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human brain using EPAS1/HIF2α Rabbit pAb (A7553) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of A549 cells using EPAS1/HIF2α antibody (A7553).
* For research use only. Not for therapeutic or diagnostic purposes.
