FREE SHIPPING IN GERMANY ON ORDERS OVER € 500 & € 1000 ACROSS EUROPE!

[KO Validated] N-Cadherin Rabbit mAb

From: €210.00

SKU: [KO Validated] N-Cadherin Rabbit mAb - A19083 - ABclonal Category:

Description

Overview

Product name [KO Validated] N-Cadherin Rabbit mAb
Catalog No. A19083
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0371

This gene encodes a classical cadherin and member of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein is proteolytically processed to generate a calcium-dependent cell adhesion molecule and glycoprotein. This protein plays a role in the establishment of left-right asymmetry, development of the nervous system and the formation of cartilage and bone.

Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human N Cadherin (P19022).
Sequence AKFLIYAQDKETQEKWQVAVKLSLKPTLTEESVKESAEVEEIVFPRQFSKHSGHLQRQKRDWVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGP
Gene ID
Swiss Prot
Synonyms CDHN; NCAD; ACOGS; ADHD8; CD325; ARVD14; CDw325
Calculated MW 100kDa
Observed MW 140kDa

Reactivity Human, Mouse, Rat
Tested applications WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition
Recommended dilution
  • WB 1:500 – 1:2000
  • IHC-P 1:50 – 1:200
  • IF/ICC 1:50 – 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, 293T, NIH/3T3, C6
Cellular location Cell membrane, Single-pass type I membrane protein
Customer validation

WB(Homo sapiens, Mus musculus, Rattus norvegicus)

IHC(Mus musculus, Homo sapiens)

IHC(Homo sapiens)

IF(Homo sapiens)

IHC(Homo sapiens)

ABclonal:Western blot - [KO Validated] N-Cadherin Rabbit mAb (A19083)}

Western blot – [KO Validated] N-Cadherin Rabbit mAb (A19083)

Western blot analysis of extracts from wild type (WT) and N-Cadherin knockout (KO) HeLa cells, using N-Cadherin antibody (A19083) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1min.
ABclonal:Western blot - [KO Validated] N-Cadherin Rabbit mAb (A19083)}

Western blot – [KO Validated] N-Cadherin Rabbit mAb (A19083)

Western blot analysis of extracts of various cell lines, using N-Cadherin antibody (A19083) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1min.
ABclonal:Immunohistochemistry - [KO Validated] N-Cadherin Rabbit mAb (A19083)}

Immunohistochemistry – [KO Validated] N-Cadherin Rabbit mAb (A19083)

Immunohistochemistry of paraffin-embedded mouse heart using N-Cadherin Rabbit mAb (A19083) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KO Validated] N-Cadherin Rabbit mAb (A19083)}

Immunohistochemistry – [KO Validated] N-Cadherin Rabbit mAb (A19083)

Immunohistochemistry of paraffin-embedded rat heart using N-Cadherin Rabbit mAb (A19083) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - [KO Validated] N-Cadherin Rabbit mAb (A19083)}

Immunofluorescence – [KO Validated] N-Cadherin Rabbit mAb (A19083)

Immunofluorescence analysis of mouse heart using N-Cadherin Rabbit mAb (A19083) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.

Datasheet

Additional information

CatalogID

A19083-100, A19083-200, A19083-50

Related products