FREE SHIPPING IN GERMANY ON ORDERS OVER € 500 & € 1000 ACROSS EUROPE!

[KO Validated] HMGB1 Rabbit mAb

From: €210.00

SKU: [KO Validated] HMGB1 Rabbit mAb - A19529 - ABclonal Category:

Description

Overview

Product name [KO Validated] HMGB1 Rabbit mAb
Catalog No. A19529
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0001

This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein.

Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human HMGB1 (P09429).
Sequence SAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEE
Gene ID
Swiss Prot
Synonyms HMG1; HMG3; HMG-1; SBP-1
Calculated MW 25kDa
Observed MW 25kDa

Reactivity Human, Mouse, Rat
Tested applications WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition
Recommended dilution
  • WB 1:500 – 1:2000
  • IHC-P 1:50 – 1:200
  • IF/ICC 1:50 – 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples 293T, HeLa, Jurkat, Mouse liver, Mouse brain, Mouse testis, Rat liver
Cellular location Cell membrane, Chromosome, Cytoplasm, Endoplasmic reticulum-Golgi intermediate compartment, Endosome, Extracellular side, Nucleus, Peripheral membrane protein, Secreted
Customer validation

IF(Rattus norvegicus, Mus musculus)

WB(Bovine, Mus musculus)

IHC(Rattus norvegicus)

ABclonal:Western blot - [KO Validated] HMGB1 Rabbit mAb (A19529)}

Western blot – [KO Validated] HMGB1 Rabbit mAb (A19529)

Western blot analysis of extracts of various cell lines, using HMGB1 antibody (A19529) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.
ABclonal:Western blot - [KO Validated] HMGB1 Rabbit mAb (A19529)}

Western blot – [KO Validated] HMGB1 Rabbit mAb (A19529)

Western blot analysis of extracts from wild type (WT) and HMGB1 knockout (KO) 293T cells, using HMGB1 antibody (A19529) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.
ABclonal:Western blot - [KO Validated] HMGB1 Rabbit mAb (A19529)}

Western blot – [KO Validated] HMGB1 Rabbit mAb (A19529)

Western blot analysis of extracts of various cell lines, using HMGB1 antibody (A19529) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.
ABclonal:Immunohistochemistry - [KO Validated] HMGB1 Rabbit mAb (A19529)}

Immunohistochemistry – [KO Validated] HMGB1 Rabbit mAb (A19529)

Immunohistochemistry of paraffin-embedded Rat brain using HMGB1 antibody (A19529) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KO Validated] HMGB1 Rabbit mAb (A19529)}

Immunohistochemistry – [KO Validated] HMGB1 Rabbit mAb (A19529)

Immunohistochemistry of paraffin-embedded Human esophagus using HMGB1 antibody (A19529) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KO Validated] HMGB1 Rabbit mAb (A19529)}

Immunohistochemistry – [KO Validated] HMGB1 Rabbit mAb (A19529)

Immunohistochemistry of paraffin-embedded Mouse kidney using HMGB1 antibody (A19529) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - [KO Validated] HMGB1 Rabbit mAb (A19529)}

Immunofluorescence – [KO Validated] HMGB1 Rabbit mAb (A19529)

Immunofluorescence analysis of C6 cells using HMGB1 antibody (A19529) at dilution of 1:100. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - [KO Validated] HMGB1 Rabbit mAb (A19529)}

Immunofluorescence – [KO Validated] HMGB1 Rabbit mAb (A19529)

Immunofluorescence analysis of NIH/3T3 cells using HMGB1 antibody (A19529) at dilution of 1:100. Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.

Datasheet

Additional information

CatalogID

A19529-100, A19529-200, A19529-50

Related products