Description
Overview
| Product name | NEK2 Rabbit pAb |
|---|---|
| Catalog No. | A5355 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
This gene encodes a serine/threonine-protein kinase that is involved in mitotic regulation. This protein is localized to the centrosome, and undetectable during G1 phase, but accumulates progressively throughout the S phase, reaching maximal levels in late G2 phase. Alternatively spliced transcript variants encoding different isoforms with distinct C-termini have been noted for this gene.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human NEK2 (NP_001191112.1). |
|---|---|
| Sequence | MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGH |
| Gene ID | |
| Swiss Prot | |
| Synonyms | NLK1; RP67; NEK2A; HsPK21; PPP1R111 |
| Calculated MW | 52kDa |
| Observed MW | 52kDa |
Applications
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | Mouse testis, Mouse thymus |
| Cellular location | Chromosome, Cytoplasm, Nucleus, centromere, centromere, centrosome, cytoskeleton, kinetochore, microtubule organizing center, nucleolus, spindle pole |
Research Area
NEK2 Rabbit pAb images
Western blot analysis of extracts of various cell lines, using NEK2 antibody (A5355) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.
* For research use only. Not for therapeutic or diagnostic purposes.
