Description
Overview
| Product name | NOV Rabbit pAb |
|---|---|
| Catalog No. | A5320 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
The protein encoded by this gene is a small secreted cysteine-rich protein and a member of the CCN family of regulatory proteins. CNN family proteins associate with the extracellular matrix and play an important role in cardiovascular and skeletal development, fibrosis and cancer development.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 32-357 of human NOV (NP_002505.1). |
|---|---|
| Sequence | TQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM |
| Gene ID | |
| Swiss Prot | |
| Synonyms | NOV; NOVh; IBP-9; IGFBP9; IGFBP-9 |
| Calculated MW | 39kDa |
| Observed MW |
Applications
| Reactivity | Human |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Immunohistochemistry |
| Positive samples | |
| Cellular location | Cell junction, Cytoplasm, Secreted, gap junction |
Research Area
NOV Rabbit pAb images
* For research use only. Not for therapeutic or diagnostic purposes.
