Description
Overview
| Product name | PIAS4 Rabbit pAb |
|---|---|
| Catalog No. | A5322 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
Enables SUMO ligase activity and ubiquitin protein ligase binding activity. Involved in negative regulation of transcription, DNA-templated; positive regulation of protein sumoylation; and protein sumoylation. Located in cytoplasm and nucleus.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 60-260 of human PIAS4 (NP_056981.2). |
|---|---|
| Sequence | ELYETRYAKKNSEPAPQPHRPLDPLTMHSTYDRAGAVPRTPLAGPNIDYPVLYGKYLNGLGRLPAKTLKPEVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVELIRNSRELQPGVKAVQVVLRICYSDTSCPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPCRPINLTHLMYLSSATNRITV |
| Gene ID | |
| Swiss Prot | |
| Synonyms | PIASY; Piasg; ZMIZ6; PIAS-gamma |
| Calculated MW | 57kDa |
| Observed MW | 57-75KDa |
Applications
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | HeLa, 293T |
| Cellular location | Nucleus, PML body |
Research Area
PIAS4 Rabbit pAb images
Western blot analysis of various lysates, using PIAS4 Rabbit pAb (A5322) at 1:400 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.
* For research use only. Not for therapeutic or diagnostic purposes.
