Description
Overview
| Product name | PSMC6 Rabbit pAb |
|---|---|
| Catalog No. | A5377 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes one of the ATPase subunits, a member of the triple-A family of ATPases which have a chaperone-like activity. Pseudogenes have been identified on chromosomes 8 and 12.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-150 of human PSMC6 (NP_002797.3). |
|---|---|
| Sequence | DKALQDYRKKLLEHKEIDGRLKELREQLKELTKQYEKSENDLKALQSVGQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKSKLKPGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGNVSYSEIG |
| Gene ID | |
| Swiss Prot | |
| Synonyms | p42; RPT5; SUG2 |
| Calculated MW | 44kDa |
| Observed MW | 45kDa |
Applications
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | NCI-H460, 293T, SH-SY5Y, Mouse liver, Mouse kidney, Mouse brain, Mouse heart, Mouse spleen |
| Cellular location | Cytoplasm, Nucleus |
Research Area
PSMC6 Rabbit pAb images
Western blot analysis of extracts of various cell lines, using PSMC6 antibody (A5377) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.
* For research use only. Not for therapeutic or diagnostic purposes.
