Description
Overview
| Product name | RanGAP1 Rabbit pAb |
|---|---|
| Catalog No. | A5381 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
This gene encodes a protein that associates with the nuclear pore complex and participates in the regulation of nuclear transport. The encoded protein interacts with Ras-related nuclear protein 1 (RAN) and regulates guanosine triphosphate (GTP)-binding and exchange. Alternative splicing results in multiple transcript variants.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 398-587 of human RanGAP1 (NP_002874.1). |
|---|---|
| Sequence | PQQRGQGEKSATPSRKILDPNTGEPAPVLSSPPPADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV |
| Gene ID | |
| Swiss Prot | |
| Synonyms | SD; Fug1; RANGAP |
| Calculated MW | 64kDa |
| Observed MW | 64kDa |
Applications
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | BT-474, HeLa, MCF7, A-549, Jurkat |
| Cellular location | Chromosome, Cytoplasm, Cytoplasmic side, Nucleus membrane, Peripheral membrane protein, centromere, cytoskeleton, kinetochore, spindle pole |
Research Area
RanGAP1 Rabbit pAb images
Western blot analysis of extracts of various cell lines, using RanGAP1 antibody (A5381) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.
* For research use only. Not for therapeutic or diagnostic purposes.
