Description
Overview
| Product name | SSCA1/SerpinB3 Rabbit pAb |
|---|---|
| Catalog No. | A5418 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
Enables cysteine-type endopeptidase inhibitor activity; protease binding activity; and virus receptor activity. Involved in several processes, including autocrine signaling; paracrine signaling; and regulation of cellular protein metabolic process. Located in cytoplasmic vesicle; extracellular exosome; and nucleus.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human SSCA1/SerpinB3 (NP_008850.1). |
|---|---|
| Sequence | MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAK |
| Gene ID | |
| Swiss Prot | |
| Synonyms | SCC; T4-A; SCCA1; SSCA1; SCCA-1; HsT1196; SCCA-PD |
| Calculated MW | 45kDa |
| Observed MW | 45KDa |
Applications
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | 293T |
| Cellular location | Cytoplasm |
Research Area
SSCA1/SerpinB3 Rabbit pAb images
Western blot analysis of 293T, using SSCA1/SerpinB3 antibody (A5418) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.
Immunofluorescence analysis of A431 cells using SSCA1/SerpinB3 Rabbit pAb (A5418) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of HepG2 cells using SSCA1/SerpinB3 Rabbit pAb (A5418) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
* For research use only. Not for therapeutic or diagnostic purposes.
