Description
Overview
| Product name | Syntenin Rabbit pAb |
|---|---|
| Catalog No. | A5360 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms. Related pseudogenes have been identified on multiple chromosomes.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human Syntenin (NP_001007068.1). |
|---|---|
| Sequence | MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILST |
| Gene ID | |
| Swiss Prot | |
| Synonyms | ST1; MDA9; SYCL; MDA-9; TACIP18 |
| Calculated MW | 32kDa |
| Observed MW | 32kDa |
Applications
| Reactivity | Human |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | HT-29, THP-1 |
| Cellular location | Cell junction, Cell membrane, Cytoplasm, Endoplasmic reticulum membrane, Melanosome, Nucleus, Peripheral membrane protein, adherens junction, cytoskeleton, cytosol, focal adhesion |
Research Area
Syntenin Rabbit pAb images
Western blot analysis of extracts of various cell lines, using Syntenin antibody (A5360) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.
Immunofluorescence analysis of U2OS cells using Syntenin antibody (A5360). Blue: DAPI for nuclear staining.
* For research use only. Not for therapeutic or diagnostic purposes.
