Description
Overview
| Product name | APLP2 Rabbit pAb |
|---|---|
| Catalog No. | A5455 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
This gene encodes amyloid precursor- like protein 2 (APLP2), which is a member of the APP (amyloid precursor protein) family including APP, APLP1 and APLP2. This protein is ubiquitously expressed. It contains heparin-, copper- and zinc- binding domains at the N-terminus, BPTI/Kunitz inhibitor and E2 domains in the middle region, and transmembrane and intracellular domains at the C-terminus. This protein interacts with major histocompatibility complex (MHC) class I molecules. The synergy of this protein and the APP is required to mediate neuromuscular transmission, spatial learning and synaptic plasticity. This protein has been implicated in the pathogenesis of Alzheimer’s disease. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 370-580 of human APLP2 (NP_001633.1). |
|---|---|
| Sequence | PTNDVDVYFETSADDNEHARFQKAKEQLEIRHRNRMDRVKKEWEEAELQAKNLPKAERQTLIQHFQAMVKALEKEAASEKQQLVETHLARVEAMLNDRRRMALENYLAALQSDPPRPHRILQALRRYVRAENKDRLHTIRHYQHVLAVDPEKAAQMKSQVMTHLHVIEERRNQSLSLLYKVPYVAQEIQEEIDELLQEQRADMDQFTASIS |
| Gene ID | |
| Swiss Prot | |
| Synonyms | APPH; APPL2; CDEBP; APLP-2 |
| Calculated MW | 87kDa |
| Observed MW | 87KDa |
Applications
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.01% thiomersal, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | Mouse brain, Mouse heart, Mouse testis, Rat brain, Rat heart |
| Cellular location | Cell membrane, Nucleus, Single-pass type I membrane protein |
Research Area
APLP2 Rabbit pAb images
Western blot analysis of extracts of various cell lines, using APLP2 Polyclonal Antibody (A5455) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.
Immunofluorescence analysis of L929 cells using APLP2 Rabbit pAb (A5455) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
* For research use only. Not for therapeutic or diagnostic purposes.
