Description
Overview
| Product name | CART Rabbit pAb |
|---|---|
| Catalog No. | A5395 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
This gene encodes a preproprotein that is proteolytically processed to generate multiple biologically active peptides. These peptides play a role in appetite, energy balance, maintenance of body weight, reward and addiction, and the stress response. Expression of a similar gene transcript in rodents is upregulated following administration of cocaine and amphetamine. Mutations in this gene are associated with susceptibility to obesity in humans.
Immunogen information
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-116 of human CART (NP_004282.1). |
|---|---|
| Sequence | EKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL |
| Gene ID | |
| Swiss Prot | |
| Synonyms | CART |
| Calculated MW | 13kDa |
| Observed MW | 13kDa |
Applications
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.01% thiomersal, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | Mouse heart |
| Cellular location | Secreted |
Research Area
CART Rabbit pAb images
Western blot analysis of extracts of mouse heart, using CART antibody (A5395) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 3min.
Immunofluorescence analysis of SH-SY5Y cells using CART Rabbit pAb (A5395) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
* For research use only. Not for therapeutic or diagnostic purposes.
