Description
Overview
| Product name | CHMP2B Rabbit pAb |
|---|---|
| Catalog No. | A5399 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-213 of human CHMP2B (NP_054762.2). |
|---|---|
| Sequence | MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD |
| Gene ID | |
| Swiss Prot | |
| Synonyms | DMT1; ALS17; VPS2B; VPS2-2; CHMP2.5; FTDALS7 |
| Calculated MW | 24kDa |
| Observed MW | 28kDa |
Applications
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | MCF7, BT-474, 22Rv1, Lovo, A-549, Mouse lung, Mouse testis, Mouse kidney |
| Cellular location | Cytoplasm, Late endosome membrane, Peripheral membrane protein, cytosol |
Research Area
CHMP2B Rabbit pAb images
Western blot analysis of extracts of various cell lines, using CHMP2B antibody (A5399) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25ug per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Basic Kit (RM00020)._Exposure time: 30s.
* For research use only. Not for therapeutic or diagnostic purposes.
