Description
Overview
| Product name | CYB5A Rabbit pAb |
|---|---|
| Catalog No. | A5401 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
The protein encoded by this gene is a membrane-bound cytochrome that reduces ferric hemoglobin (methemoglobin) to ferrous hemoglobin, which is required for stearyl-CoA-desaturase activity. Defects in this gene are a cause of type IV hereditary methemoglobinemia. Three transcript variants encoding different isoforms have been found for this gene.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CYB5A (NP_683725.1). |
|---|---|
| Sequence | MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLI |
| Gene ID | |
| Swiss Prot | |
| Synonyms | CYB5; MCB5; METAG |
| Calculated MW | 15kDa |
| Observed MW | 17kDa |
Applications
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | MCF7, A-549, HT-29, 293T, M21 |
| Cellular location | Cytoplasm, Cytoplasmic side, Endoplasmic reticulum membrane, Microsome membrane, Single-pass membrane protein |
Research Area
CYB5A Rabbit pAb images
Western blot analysis of extracts of various cell lines, using CYB5A antibody (A5401) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 120s.
Immunohistochemistry of paraffin-embedded rat kidney using CYB5A antibody (A5401) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded mouse heart using CYB5A antibody (A5401) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of C6 cells using CYB5A Polyclonal Antibody (A5401) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
* For research use only. Not for therapeutic or diagnostic purposes.
