Description
Overview
| Product name | EFNA1 Rabbit pAb |
|---|---|
| Catalog No. | A5341 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin which binds to the EPHA2, EPHA4, EPHA5, EPHA6, and EPHA7 receptors. Two transcript variants that encode different isoforms were identified through sequence analysis.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-182 of human EFNA1 (NP_004419.2). |
|---|---|
| Sequence | DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHS |
| Gene ID | |
| Swiss Prot | |
| Synonyms | B61; EFL1; GMAN; ECKLG; EPLG1; LERK1; LERK-1; TNFAIP4 |
| Calculated MW | 24kDa |
| Observed MW | 21-23kDa |
Applications
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | H460, Mouse testis |
| Cellular location | Cell membrane, GPI-anchor, Lipid-anchor, Secreted |
Research Area
EFNA1 Rabbit pAb images
Western blot analysis of extracts of various cell lines, using EFNA1 antibody (A5341) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 30s.
Immunohistochemistry of paraffin-embedded human prostate using EFNA1 Antibody (A5341) at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded human esophagus using EFNA1 Antibody (A5341) at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse stomach using EFNA1 Antibody (A5341) at dilution of 1:100 (40x lens).
* For research use only. Not for therapeutic or diagnostic purposes.
