Description
Overview
| Product name | GALNS Rabbit pAb |
|---|---|
| Catalog No. | A5461 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
This gene encodes N-acetylgalactosamine-6-sulfatase which is a lysosomal exohydrolase required for the degradation of the glycosaminoglycans, keratan sulfate, and chondroitin 6-sulfate. Sequence alterations including point, missense and nonsense mutations, as well as those that affect splicing, result in a deficiency of this enzyme. Deficiencies of this enzyme lead to Morquio A syndrome, a lysosomal storage disorder.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 353-522 of human GALNS (NP_000503.1). |
|---|---|
| Sequence | AGLTPPSDRAIDGLNLLPTLLQGRLMDRPIFYYRGDTLMAATLGQHKAHFWTWTNSWENFRQGIDFCPGQNVSGVTTHNLEDHTKLPLIFHLGRDPGERFPLSFASAEYQEALSRITSVVQQHQEALVPAQPQLNVCNWAVMNWAPPGCEKLGKCLTPPESIPKKCLWSH |
| Gene ID | |
| Swiss Prot | |
| Synonyms | GAS; MPS4A; GalN6S; GALNAC6S |
| Calculated MW | 58kDa |
| Observed MW | 55kDa |
Applications
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | MCF7, HT-29, 293T, Mouse kidney, Mouse brain, Mouse intestine |
| Cellular location | Lysosome |
Research Area
GALNS Rabbit pAb images
Western blot analysis of extracts of various cell lines, using GALNS antibody (A5461) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 15s.
Immunofluorescence analysis of C6 cells using GALNS Rabbit pAb (A5461) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of L929 cells using GALNS Rabbit pAb (A5461) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
* For research use only. Not for therapeutic or diagnostic purposes.
