Description
Overview
| Product name | GFER Rabbit pAb |
|---|---|
| Catalog No. | A5463 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
The hepatotrophic factor designated augmenter of liver regeneration (ALR) is thought to be one of the factors responsible for the extraordinary regenerative capacity of mammalian liver. It has also been called hepatic regenerative stimulation substance (HSS). The gene resides on chromosome 16 in the interval containing the locus for polycystic kidney disease (PKD1). The putative gene product is 42% similar to the scERV1 protein of yeast. The yeast scERV1 gene had been found to be essential for oxidative phosphorylation, the maintenance of mitochondrial genomes, and the cell division cycle. The human gene is both the structural and functional homolog of the yeast scERV1 gene.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 81-205 of human GFER (NP_005253.3). |
|---|---|
| Sequence | MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD |
| Gene ID | |
| Swiss Prot | |
| Synonyms | ALR; HPO; HSS; ERV1; HPO1; HPO2; HERV1; MMCHD; MPMCD |
| Calculated MW | 23kDa |
| Observed MW | 23kDa |
Applications
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | MCF7, A375, Mouse liver, Mouse testis, Mouse brain, Rat liver, Rat brain |
| Cellular location | Cytoplasm, Mitochondrion intermembrane space, Secreted |
Research Area
GFER Rabbit pAb images
Western blot analysis of extracts of various cell lines, using GFER antibody (A5463) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25ug per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.
* For research use only. Not for therapeutic or diagnostic purposes.
