Description
Overview
| Product name | HDC Rabbit pAb |
|---|---|
| Catalog No. | A5465 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
This gene encodes a member of the group II decarboxylase family and forms a homodimer that converts L-histidine to histamine in a pyridoxal phosphate dependent manner. Histamine regulates several physiologic processes, including neurotransmission, gastric acid secretion, inflamation, and smooth muscle tone.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 453-662 of human HDC (NP_002103.2). |
|---|---|
| Sequence | QFTTRDDILRDWNLIRDAATLILSQHCTSQPSPRVGNLISQIRGARAWACGTSLQSVSGAGDDPVQARKIIKQPQRVGAGPMKRENGLHLETLLDPVDDCFSEEAPDATKHKLSSFLFSYLSVQTKKKTVRSLSCNSVPVSAQKPLPTEASVKNGGSSRVRIFSRFPEDMMMLKKSAFKKLIKFYSVPSFPECSSQCGLQLPCCPLQAMV |
| Gene ID | |
| Swiss Prot | |
| Synonyms | HDC |
| Calculated MW | 74kDa |
| Observed MW | 85kDa |
Applications
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | K-562, Mouse liver |
| Cellular location | cytoplasm, cytosol |
Research Area
HDC Rabbit pAb images
Western blot analysis of extracts of various cell lines, using HDC antibody (A5465) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.
* For research use only. Not for therapeutic or diagnostic purposes.
