Description
Overview
| Product name | MYL2 Rabbit pAb |
|---|---|
| Catalog No. | A5473 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
This gene encodes a major sarcomeric protein in mammalian striated muscle. The encoded protein plays a role in embryonic heart muscle structure and function, while phosphorylation of the encoded protein is involved in cardiac myosin cycling kinetics, torsion and function in adults. Mutations in this gene are associated with hypertrophic cardiomyopathy 10 and infant-onset myopathy.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-166 of human MYL2 (NP_000423.2). |
|---|---|
| Sequence | MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD |
| Gene ID | |
| Swiss Prot | |
| Synonyms | MLC2; CMH10; MFM12; MLC-2; MLC-2v; MLC-2s/v |
| Calculated MW | 19kDa |
| Observed MW | 16kDa |
Applications
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | MCF7, Mouse skeletal muscle |
| Cellular location | A band, Cytoplasm, myofibril, sarcomere |
Research Area
MYL2 Rabbit pAb images
Western blot analysis of extracts of various cell lines, using MYL2 antibody (A5473) at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.
Immunofluorescence analysis of rat heart using MYL2 Rabbit pAb (A5473) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse heart using MYL2 Rabbit pAb (A5473) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
* For research use only. Not for therapeutic or diagnostic purposes.
