Description
Overview
| Product name | Myoglobin Rabbit pAb |
|---|---|
| Catalog No. | A5471 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
This gene encodes a member of the globin superfamily and is predominantly expressed in skeletal and cardiac muscles. The encoded protein forms a monomeric globular haemoprotein that is primarily responsible for the storage and facilitated transfer of oxygen from the cell membrane to the mitochondria. This protein also plays a role in regulating physiological levels of nitric oxide. Multiple transcript variants encoding distinct isoforms exist for this gene.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-1-154 of human Myoglobin (NP_005359.1). |
|---|---|
| Sequence | MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG |
| Gene ID | |
| Swiss Prot | |
| Synonyms | MYOSB; PVALB |
| Calculated MW | 17kDa |
| Observed MW | 17KDa |
Applications
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | Mouse heart, Rat heart |
| Cellular location | cytosol, extracellular exosome |
Research Area
Myoglobin Rabbit pAb images
Western blot analysis of various lysates, using Myoglobin antibody (A5471) at 1:400 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.
Immunofluorescence analysis of rat skeletal muscle cells using Myoglobin Rabbit pAb (A5471) at dilution of 1:300 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse skeletal muscle cells using Myoglobin Rabbit pAb (A5471) at dilution of 1:300 (40x lens). Blue: DAPI for nuclear staining.
* For research use only. Not for therapeutic or diagnostic purposes.
