Description
Overview
| Product name | P23/PTGES3 Rabbit pAb |
|---|---|
| Catalog No. | A5325 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
This gene encodes an enzyme that converts prostaglandin endoperoxide H2 (PGH2) to prostaglandin E2 (PGE2). This protein functions as a co-chaperone with heat shock protein 90 (HSP90), localizing to response elements in DNA and disrupting transcriptional activation complexes. Alternative splicing results in multiple transcript variants. There are multiple pseudogenes of this gene on several different chromosomes.
Immunogen information
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human P23/P23/PTGES3 (NP_006592.3). |
|---|---|
| Sequence | MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLS |
| Gene ID | |
| Swiss Prot | |
| Synonyms | P23; TEBP; cPGES |
| Calculated MW | 19kDa |
| Observed MW | 23kDa |
Applications
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.01% thiomersal, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | HeLa, Jurkat, Mouse testis, Rat testis |
| Cellular location | Cytoplasm |
Research Area
P23/PTGES3 Rabbit pAb images
Western blot analysis of extracts of various cell lines, using P23/P23/PTGES3 antibody (A5325) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.
* For research use only. Not for therapeutic or diagnostic purposes.
