Description
Overview
| Product name | PLA2G1B Rabbit pAb |
|---|---|
| Catalog No. | A5478 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
This gene encodes a secreted member of the phospholipase A2 (PLA2) class of enzymes, which is produced by the pancreatic acinar cells. The encoded calcium-dependent enzyme catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to release arachidonic acid (AA) and lysophospholipids. AA is subsequently converted by downstream metabolic enzymes to several bioactive lipophilic compounds (eicosanoids), including prostaglandins (PGs) and leukotrienes (LTs). The enzyme may be involved in several physiological processes including cell contraction, cell proliferation and pathological response.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 23-148 of human PLA2G1B (NP_000919.1). |
|---|---|
| Sequence | AVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS |
| Gene ID | |
| Swiss Prot | |
| Synonyms | PLA2; PLA2A; PPLA2 |
| Calculated MW | 16kDa |
| Observed MW | 16kDa |
Applications
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.01% thiomersal, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | A-549, Mouse pancreas, Mouse small intestine |
| Cellular location | Secreted |
Research Area
PLA2G1B Rabbit pAb images
Western blot analysis of extracts of various cell lines, using PLA2G1B antibody (A5478) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit (RM00021).Exposure time: 90s.
Immunohistochemistry of paraffin-embedded mouse pancreas using PLA2G1B antibody (A5478) at dilution of 1:100 (40x lens).
* For research use only. Not for therapeutic or diagnostic purposes.
