Description
Overview
| Product name | PNN Rabbit pAb |
|---|---|
| Catalog No. | A16954 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
Enables RNA binding activity. Predicted to be involved in cell adhesion and mRNA splicing, via spliceosome. Predicted to act upstream of or within cell-cell adhesion. Located in nuclear speck. Part of catalytic step 2 spliceosome. Colocalizes with exon-exon junction complex.
Immunogen information
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PNN (NP_002678.2). |
|---|---|
| Sequence | MAVAVRTLQEQLEKAKESLKNVDENIRKLTGRDPNDVRPIQARLLALSGPGGGRGRGSLLLRRGFSDSGGGPPAKQRDLEGAVSRLGGERRTRRESRQES |
| Gene ID | |
| Swiss Prot | |
| Synonyms | DRS; DRSP; SDK3; memA |
| Calculated MW | 82kDa |
| Observed MW | 130kDa |
Applications
| Reactivity | Human, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.01% thiomersal, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | LO2, HeLa, PC-12 |
| Cellular location | cell-cell junction, desmosome, nuclear speck, plasma membrane |
Research Area
PNN Rabbit pAb images
Western blot analysis of extracts of various cell lines, using PNN Rabbit pAb (A16954) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 120s.
* For research use only. Not for therapeutic or diagnostic purposes.
