Description
Overview
| Product name | PSMB2 Rabbit pAb |
|---|---|
| Catalog No. | A5483 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-201 of human PSMB2 (NP_002785.1). |
|---|---|
| Sequence | MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS |
| Gene ID | |
| Swiss Prot | |
| Synonyms | HC7-I |
| Calculated MW | 23kDa |
| Observed MW | 23KDa |
Applications
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunoprecipitation |
| Positive samples | HeLa, 293T, SH-SY5Y, Mouse brain, Mouse liver, Rat liver |
| Cellular location | Cytoplasm, Nucleus |
Research Area
PSMB2 Rabbit pAb images
Western blot analysis of extracts of various cell lines, using PSMB2 antibody (A5483) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.
Western blot analysis of extracts of various cell lines, using PSMB2 antibody (A5483) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.
Immunohistochemistry of paraffin-embedded human esophageal cancer using PSMB2 Rabbit pAb (A5483) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug PSMB2 antibody (A5483). Western blot was performed from the immunoprecipitate using PSMB2 antibody (A5483) at a dilution of 1:1000.
* For research use only. Not for therapeutic or diagnostic purposes.
