Description
Overview
| Product name | SIGMAR1 Rabbit pAb |
|---|---|
| Catalog No. | A5479 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
This gene encodes a receptor protein that interacts with a variety of psychotomimetic drugs, including cocaine and amphetamines. The receptor is believed to play an important role in the cellular functions of various tissues associated with the endocrine, immune, and nervous systems. As indicated by its previous name, opioid receptor sigma 1 (OPRS1), the product of this gene was erroneously thought to function as an opioid receptor; it is now thought to be a non-opioid receptor. Mutations in this gene has been associated with juvenile amyotrophic lateral sclerosis 16. Alternative splicing of this gene results in transcript variants encoding distinct isoforms.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 114-223 of human SIGMAR1 (NP_005857.1). |
|---|---|
| Sequence | RGHSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTYLFGQDP |
| Gene ID | |
| Swiss Prot | |
| Synonyms | SRBP; ALS16; DSMA2; OPRS1; SR-BP; SIG-1R; SR-BP1; sigma1R; hSigmaR1 |
| Calculated MW | 25kDa |
| Observed MW | 25kDa |
Applications
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | HL-60, 293T, SKOV3, Mouse liver, Rat liver |
| Cellular location | Cell junction, Cell membrane, Cell projection, Endoplasmic reticulum membrane, Lipid droplet, Nucleus inner membrane, Nucleus outer membrane, growth cone |
Research Area
- Research Area & PathwaysCancerTumor biomarkers
- Research Area & PathwaysNeuroscienceNeurodegenerative DiseasesAmyloid Plaque and Neurofibrillary Tangle Formation in Alzheimer’s Disease
- Research Area & PathwaysCardiovascularHeartCardiac metabolism
- Research Area & PathwaysCardiovascularHeartHypertrophy
SIGMAR1 Rabbit pAb images
Western blot analysis of extracts of various cell lines, using SIGMAR1 antibody (A5479) at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.
Immunohistochemistry of paraffin-embedded human stomach using SIGMAR1 antibody (A5479) (40x lens).
Immunohistochemistry of paraffin-embedded mouse brain using SIGMAR1 antibody (A5479) (40x lens).
Immunohistochemistry of paraffin-embedded mouse kidney using SIGMAR1 antibody (A5479) (40x lens).
* For research use only. Not for therapeutic or diagnostic purposes.
