Description
Overview
| Product name | SULT2A1 Rabbit pAb |
|---|---|
| Catalog No. | A5489 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
This gene encodes a member of the sulfotransferase family. Sulfotransferases aid in the metabolism of drugs and endogenous compounds by converting these substances into more hydrophilic water-soluble sulfate conjugates that can be easily excreted. This protein catalyzes the sulfation of steroids and bile acids in the liver and adrenal glands, and may have a role in the inherited adrenal androgen excess in women with polycystic ovary syndrome.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-145 of human SULT2A1 (NP_003158.2). |
|---|---|
| Sequence | MSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKS |
| Gene ID | |
| Swiss Prot | |
| Synonyms | HST; ST2; STD; hSTa; DHEAS; ST2A1; ST2A3; DHEA-ST; SULT2A3; DHEA-ST8 |
| Calculated MW | 34kDa |
| Observed MW | 34kDa |
Applications
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | Mouse skeletal muscle, Mouse liver |
| Cellular location | Cytoplasm |
Research Area
SULT2A1 Rabbit pAb images
Western blot analysis of extracts of various cell lines, using SULT2A1 antibody (A5489) at 1:2000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.
* For research use only. Not for therapeutic or diagnostic purposes.
