Description
Overview
| Product name | UTS2 Rabbit pAb |
|---|---|
| Catalog No. | A5334 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
This gene encodes a mature peptide that is an active cyclic heptapeptide absolutely conserved from lamprey to human. The active peptide acts as a vasoconstrictor and is expressed only in brain tissue. Despite the gene family name similarity, this gene is not homologous to urocortin, a member of the sauvagine/corticotropin-releasing factor/urotensin I family. Most of the proprotein is cleaved to make the mature peptide. Transcript variants encoding different preproprotein isoforms have been described for this gene.
Immunogen information
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50 to the C-terminus of human UTS2 (NP_006777.1). |
|---|---|
| Sequence | ASLLQILPEMLGAERGDILRKADSSTNIFNPRGNLRKFQDFSGQDPNILLSHLLARIWKPYKKRETPDCFWKYCV |
| Gene ID | |
| Swiss Prot | |
| Synonyms | UII; U-II; UCN2; PRO1068 |
| Calculated MW | 14kDa |
| Observed MW | 17kDa |
Applications
| Reactivity | Human, Mouse |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.01% thiomersal, 50% glycerol, pH7.3. |
| Key application | Western blotting |
| Positive samples | Mouse skeletal muscle, Mouse testis, Mouse liver |
| Cellular location | Secreted |
Research Area
UTS2 Rabbit pAb images
Western blot analysis of extracts of various cell lines, using UTS2 antibody (A5334) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 90s.
* For research use only. Not for therapeutic or diagnostic purposes.
