Description
Overview
| Product name | VAPB Rabbit pAb |
|---|---|
| Catalog No. | A5363 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
Background
The protein encoded by this gene is a type IV membrane protein found in plasma and intracellular vesicle membranes. The encoded protein is found as a homodimer and as a heterodimer with VAPA. This protein also can interact with VAMP1 and VAMP2 and may be involved in vesicle trafficking.
Immunogen information
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 127-222 of human VAPB (NP_004729.1). |
|---|---|
| Sequence | AENDKPHDVEINKIISTTASKTETPIVSKSLSSSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPISALAPTGKEEGLST |
| Gene ID | |
| Swiss Prot | |
| Synonyms | ALS8; VAP-B; VAMP-B |
| Calculated MW | 27kDa |
| Observed MW | 27KDa |
Applications
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles.Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | Mouse lung, Mouse brain, Mouse kidney, Rat heart |
| Cellular location | Endoplasmic reticulum membrane, Single-pass type IV membrane protein |
Research Area
VAPB Rabbit pAb images
Western blot analysis of extracts of various cell lines, using VAPB antibody (A5363) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.
Immunohistochemistry of paraffin-embedded human colon carcinoma using VAPB Rabbit pAb (A5363) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry of paraffin-embedded human esophageal cancer using VAPB Rabbit pAb (A5363) at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunofluorescence analysis of U2OS cells using VAPB Rabbit pAb (A5363) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
* For research use only. Not for therapeutic or diagnostic purposes.
